(data stored in ACNUC1104 zone)

EMBL: AP008957.PE416

AP008957.PE416       Location/Qualifiers
FT   CDS_pept        complement(465371..465712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31124"
FT                   /db_xref="InterPro:IPR028956"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN72"
FT                   /protein_id="BAH31124.1"
FT                   /translation="MTSPSIEPLQLFETSPGNWSLMLTDQHFGKVAAVFEQVEGFEGSG
FT                   YDWASVAHAVVGRDAQHLDGRFGTDPEAGMFVAYGSDNEALGELGVLLAKAYSDAEYLG
FT                   GLVAISELD"
     atgacatcac catcgatcga accgctacag cttttcgaaa cgtctccggg caactggtca        60
     ctgatgctca ccgaccagca tttcggcaag gtagcagcgg tattcgagca ggtagagggt       120
     ttcgaaggct ccggttacga ctgggcgtcg gtcgcccacg cagtggtagg ccgcgatgca       180
     cagcatctgg acggccgctt cggcaccgat cccgaggccg gcatgtttgt cgcgtacggc       240
     agcgacaacg aagctcttgg tgaactcgga gtgcttctcg ccaaagcgta ttcggatgcc       300
     gagtacctcg gcggcctggt cgccatttcc gaactcgact ag                          342
//

If you have problems or comments...

PBIL Back to PBIL home page