(data stored in ACNUC1104 zone)

EMBL: AP008957.PE42

AP008957.PE42        Location/Qualifiers
FT   CDS_pept        complement(50870..51946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30750"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLI2"
FT                   /protein_id="BAH30750.1"
FT                   /translation="MEAGRRKISAVTNLPLRPIHSSAGHRPYKQAPSRNPFRAMKGTVV
FT                   KKLDYDLVGEQLFSNPKVRARIERHYRLPTDAATASQFLDYAVRHLDQEAMDNPLTQTY
FT                   SNQQVFKAAVNALGSNSRSWASFVKVRDQHLEGLLHGFDPEKTHTAILDGTVTLTDIRE
FT                   HLSGQSGIGDARAIVRWAALLTAQPNYYQQILVIARAFVDLAADADHPLDNEHLMMCLA
FT                   GYLIAPPRRWPGDKHIDTDILLMTPRERDLPGMGYPLASEFLRNLHWNGFKPDRHITRL
FT                   LRLWVPELRDTVDPDVDRLCRLIGSRNQSLRYFLKYSLIGVAITPDGNYSRADNLIWML
FT                   GAYLEKKNKESDVQYIHD"
     gtggaggctg ggcgaagaaa gatcagcgcg gtaaccaatc tgccactaag gccgatccac        60
     agttcagcgg gacatcggcc atacaagcaa gcgccctccc gcaatccgtt tcgggcgatg       120
     aagggcacag tagtgaagaa actggactac gacctggtcg gtgaacaact gttctcgaac       180
     ccgaaggtaa gagcacgtat cgaacggcac taccgcctcc ccaccgatgc tgccaccgcg       240
     tcgcagttcc tcgactacgc ggtacgccac ctcgatcagg aagcgatgga caaccccctc       300
     actcagacct acagcaacca acaggtcttc aaagctgcag tcaacgccct cggcagtaac       360
     tcccggagct gggcgagttt cgtcaaggtc cgtgaccagc acctcgaagg gcttctccac       420
     ggcttcgacc ccgaaaagac gcacaccgcc atcctcgacg ggacggtgac cctcaccgat       480
     atccgtgagc acctcagcgg gcaaagcgga atcggcgatg cgagggcaat cgtccgctgg       540
     gccgccctgc tgaccgctca accgaactac taccaacaga tcctcgtaat cgcccgcgcc       600
     ttcgtcgacc tcgcagccga tgccgaccac ccgctcgaca acgagcatct gatgatgtgc       660
     ctcgccggct acctgatcgc gcccccacgc cgctggccag gcgataaaca catcgacacg       720
     gacatcctgt taatgacgcc gcgcgagcga gacctccccg ggatgggcta tcccctcgcc       780
     agtgaattcc tccgcaacct gcattggaac ggcttcaaac ccgaccgcca tatcaccagg       840
     ctcctgaggc tctgggttcc cgaactccga gacaccgtcg accccgacgt cgatcgtctc       900
     tgcaggttga tcggaagccg aaaccagtcc ctgcgctact tcctcaaata ctcactgatc       960
     ggcgttgcca tcaccccgga cggcaactac tcccgcgccg acaacctcat ctggatgctc      1020
     ggcgcgtacc tggaaaagaa gaataaggaa tcggacgtgc agtacatcca cgactag         1077
//

If you have problems or comments...

PBIL Back to PBIL home page