(data stored in ACNUC1104 zone)

EMBL: AP008957.PE420

AP008957.PE420       Location/Qualifiers
FT   CDS_pept        complement(469357..470622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31128"
FT                   /db_xref="GOA:C0ZN76"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN76"
FT                   /protein_id="BAH31128.1"
FT                   /translation="MGLRGRLWQLSASELRAAAIEASAEILRLEAVRVAVVDELSMRPD
FT                   DQVIASRGVGAWLAANTMLQIRDGKKIAALGAALRPFPAVAARFDVGDCSFEHAVLIVA
FT                   FCESPPKGMPEEALPRCIDLLKAAASGVEATTTKVRNVIATLERIFESDLIPPAEDIDR
FT                   NELRIASTLNGRVVVRGDFDALTGEMLLSALSNLTMPTPAPDGTPDARSAAKRTADGFT
FT                   ELIRRYLDCAKTGVDGGQRPHVNVHINARDLAEHRDCATTSSSSGGGASASDLDVGHMP
FT                   WLGPLSVSQTRLLGCDCFLSTVLLDGHGAPLDAKPGKRLVTAEQRVALIARDKGCSFPG
FT                   CTCVPAWTDAHHIRHWANGGPTVMNNLVLLCRSHHRLMHRKTGFVGKWVIRIGVDNKPW
FT                   FIPPPSIDPQQHPRPANTTFKT"
     gtggggttgc gcggacgtct gtggcagctg tctgcttctg agttgcgtgc tgctgctatc        60
     gaagcgagtg cggagattct tcgtctcgag gctgtgcgtg tggcggtggt ggacgagttg       120
     tcgatgcggc ccgatgatca ggtgatcgcc agccgcgggg tgggtgcgtg gttggcggcc       180
     aacacgatgc tgcaaatccg ggacgggaag aagatcgccg ccctcggtgc agcgctgcgc       240
     ccgtttcccg cggtggcagc tcggttcgat gtcggggact gctccttcga gcacgccgtg       300
     ttgatcgtgg cgttctgcga atcaccaccg aaggggatgc cggaggaggc gctccctcgc       360
     tgtatcgact tgttgaaggc tgccgcttcc ggtgtcgagg ccacgaccac gaaggtccgc       420
     aacgtcatcg cgaccttgga gcgcattttc gaatccgatt tgattccacc cgccgaagat       480
     atcgaccgca acgagctccg gatcgcgtcg acgttgaacg gccgggtggt ggtgcgcggt       540
     gatttcgacg ccctcaccgg tgaaatgttg ttgtcggcgt tgtcgaatct gacgatgccc       600
     acccctgcac ccgatggaac ccccgatgcc cggtcggcag cgaagcggac tgcggatggg       660
     ttcaccgaac tgatccgccg gtatctggac tgcgcgaaaa ccggtgtcga tggtggtcag       720
     cgtccgcacg tgaacgttca catcaacgcc cgcgacctcg ccgagcaccg ggactgcgcg       780
     actacatcct cctcttctgg tggcggagcg tctgcgtcgg atctcgatgt cgggcacatg       840
     ccctggctcg gaccactgtc cgtctcgcag accagactcc tcggctgcga ctgcttcctg       900
     tccaccgtac tgctcgacgg tcacggcgca ccgctcgatg cgaaacccgg gaaacggttg       960
     gtcaccgcgg agcagcgagt ggcgttgatc gcgagagaca aaggctgctc cttccccggc      1020
     tgcacatgcg tgcccgcctg gaccgacgcg caccatatcc ggcactgggc caacggtggc      1080
     ccgaccgtga tgaacaacct tgtcctgctg tgccgttcac atcaccggct gatgcaccgg      1140
     aaaaccgggt tcgtcgggaa atgggtgatc cggatcgggg tcgacaacaa accgtggttc      1200
     atcccgccgc cctcgatcga cccgcagcag cacccgcgac cggccaacac cacattcaaa      1260
     acctga                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page