(data stored in ACNUC1104 zone)

EMBL: AP008957.PE438

AP008957.PE438       Location/Qualifiers
FT   CDS_pept        complement(488047..489591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04380"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31146"
FT                   /db_xref="GOA:C0ZN94"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN94"
FT                   /protein_id="BAH31146.1"
FT                   /translation="MSHTKVSDTATISLRGVCKSYGPVHALQDVSLDVSRGDVLGLIGE
FT                   NGAGKSTLIGVLTGTVRPDAGSLDVNGTHVELGDSRTLRELGISVVVQEQSLVDALRVY
FT                   ENIYLGREGEIGGWGPGRRRRMRDAAQSLLDTLGIEGLRADAVVAELTYPQRQLVEIAR
FT                   AFSRITDATEAPVILLDEPTSALTETEVEILFALIEGWRDRVSFIFVSHILQDVLRIST
FT                   RLLVLRDGRSIETLSADGVTAERLHELMVGSERSADYYREGEQTGALSPKPLIELRDAS
FT                   SAGEFESVDLVVRPGEVVGLAGVIGSGKASVAAAVAGAESLSTGSIHVDGTAHEHWSVP
FT                   AAVAAGVLYVPPERAQDSLFRSASIRNNISIGFLDLLRHPWTRLLRLRTERERTTQLAR
FT                   ALQVKAPSLSTPIGELSGGNQQKAIFARWQGRECKVLVLSDPTRGIDVGTREEIYGLVR
FT                   SMAASGVGVLLCAESLEEVIGMSDRIVVMKDGVISAELAAPAERKPAEVDVIKHMM"
     atgagtcata cgaaggtgag cgacacagca accatcagct tgcgcggggt ctgcaagagc        60
     tacggccccg ttcacgccct ccaggacgtt tcactcgacg tcagcagagg tgatgttctc       120
     ggcttgatcg gcgagaacgg tgccggaaag tcaacgctga tcggtgtttt gacgggaacg       180
     gtacgtcccg atgccggcag cctcgacgta aacggaactc acgtcgaact cggcgactcg       240
     cgcactctcc gcgaactcgg aatctccgtg gtggtccagg agcagtcgtt ggtcgatgca       300
     ctgcgcgtgt acgagaacat ttatctcgga cgtgagggcg agataggtgg ttggggcccc       360
     ggccggcgtc ggagaatgcg cgacgccgcc caatccctcc tcgacacact cggcatcgag       420
     gggttgcgcg ccgatgccgt cgtcgccgaa ttgacgtacc cacaaaggca actggtcgag       480
     attgcgcgcg ccttctcgcg gatcaccgac gccaccgaag ctccggtgat cctgctcgac       540
     gagccgacca gcgcgttgac cgagaccgag gtggaaattc tcttcgcgtt gatcgaaggg       600
     tggcgcgatc gggtgtcgtt catcttcgtg tcccacatcc tgcaggacgt cttgcggatc       660
     agcacacggc tcctcgtact gcgcgacggg aggtccatcg aaaccctctc cgccgacggc       720
     gtcactgcgg agcgactgca cgagttgatg gtgggtagcg agcgtagcgc cgactactac       780
     cgagaaggag aacagaccgg agcgttgtct ccgaagcctt tgatcgaact ccgagatgca       840
     agcagcgcag gcgagttcga gtcggtcgat ctggttgtcc gaccgggcga ggtagtcgga       900
     ttggccggag tcatcggttc ggggaaagca tcggtggctg cagcagtcgc gggtgcggag       960
     tcgttgtcga cgggttcgat tcacgtcgac ggtactgcgc acgagcactg gtcggttccc      1020
     gccgccgtgg cagccggagt cctgtacgtc ccaccggagc gtgcccagga ctccctgttc      1080
     cgcagcgcgt ccatcagaaa caacatctcg atcggcttcc tcgatctcct ccgccacccg      1140
     tggacgcggc tactgcgttt acggaccgaa agggagcgga cgacgcagtt ggcccgcgcg      1200
     ctgcaggtca aagccccgtc gttgtcgacg cctatcgggg aactcagtgg cggaaaccaa      1260
     cagaaggcga tcttcgctcg gtggcaaggt cgcgaatgca aagtgctggt cctcagcgat      1320
     ccgacgcgtg gaatcgacgt cggaacgcga gaggagatct acggtttggt ccgatcgatg      1380
     gctgcgtcag gggtcggtgt gctgctgtgc gccgaatccc tcgaagaagt gatcggaatg      1440
     tccgaccgaa tcgtggtcat gaaggacggg gtcatcagcg cagagttggc ggcccctgca      1500
     gagcgcaagc ccgccgaagt cgacgtgatc aagcacatga tgtga                      1545
//

If you have problems or comments...

PBIL Back to PBIL home page