(data stored in ACNUC1104 zone)

EMBL: AP008957.PE439

AP008957.PE439       Location/Qualifiers
FT   CDS_pept        complement(489594..490898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04390"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31147"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN95"
FT                   /protein_id="BAH31147.1"
FT                   /translation="MIMPSIESKIVDVARNATFSHPLTRRSFFAAMGAAGIALGAVACG
FT                   AGGSSTSTAAGGGAGAGKVQEKTLCQVTTLSNDYFVAFSDGGKQAMDALGVSMSSVEDQ
FT                   GNVNTALGQVGNVRASGGKSIFGTPATEAQAAAVTKACQAAGILYASSYTAPAWYTPAD
FT                   ADKWVRFITPPSTKIAVATAKALFDKVGGSGTIIHVPGQKGSSSDDQRTAGLNAAAKDY
FT                   PGIKIVTASPGNWTSEDARKAFTNILPSVPDFVGVFAQNDSQAAGVIAALDAAKITGKI
FT                   VVGFDGNKQNVEYIAQGKQYLTSATVGGLTAGILGVTIFDQLNGVDLSLPERFLSQGAL
FT                   LVTPEIADDVLKTVYAPTLPFDWAKMSKALHPDDWDPQTVLNPIDPREYYAGVSQDQYT
FT                   LNSAWNSADITGVRTEYASAFRSGPLLQYKDQLVA"
     gtgatcatgc cttcgatcga atcgaagatc gtggacgtcg cgcggaacgc gacgttctct        60
     catccactga cccgacgttc cttcttcgcc gcaatgggcg cagcaggcat cgccctcggc       120
     gcagtggcct gcggagcagg cggcagttcc accagtaccg ctgccggcgg tggcgccggc       180
     gcgggcaaag tccaggaaaa gaccctctgc caggtgacaa cactctccaa cgactacttc       240
     gttgccttct cggacggcgg caagcaggcg atggacgcgt tgggcgtcag catgtcctcg       300
     gtggaggatc agggcaacgt caacaccgca ctgggacagg taggcaacgt ccgcgcttcg       360
     ggcggcaagt cgatcttcgg cactcccgcc accgaagctc aggcggcagc cgtcacgaaa       420
     gcctgtcagg cggccgggat tctgtatgcc agctcgtaca cggcacccgc ctggtacaca       480
     ccggccgacg cggacaagtg ggtccgtttc atcacgccgc cctccaccaa gatcgccgtc       540
     gcaaccgcca aggctctttt cgacaaggtc ggcggcagcg gaaccatcat tcatgttccg       600
     ggacagaagg gttcgtcctc cgacgatcaa cggacagctg gcctgaacgc cgcggccaag       660
     gactacccgg gaatcaagat cgtcaccgcc tcgcccggca actggacttc cgaagacgcg       720
     agaaaggcat tcacgaacat cctgccttcg gtgccggact tcgtcggagt cttcgcgcag       780
     aacgacagtc aagccgccgg agtcattgcg gcactggacg ccgcgaagat cacgggcaag       840
     atcgtggtcg gattcgacgg taacaagcag aacgtcgaat acatcgcgca gggaaagcaa       900
     tacctgacca gtgcaacggt cggcggactc acggcaggaa ttctcggtgt caccatcttc       960
     gatcagctca acggcgtcga cctgtctctg ccggagcgct tcctttcgca gggagcactc      1020
     ctggtgactc cggagatcgc cgacgacgta ctgaaaactg tgtacgcgcc cacacttccg      1080
     ttcgactggg caaaaatgag caaggccctg catcctgacg actgggaccc gcagaccgta      1140
     ctcaacccga tcgacccgcg ggagtactac gccggtgtat cgcaggacca gtacacgctg      1200
     aacagcgcct ggaactctgc agacatcacc ggagtacgca ccgagtacgc ctccgcgttc      1260
     cgctcgggcc cgttgctgca gtacaaagat caactcgtgg cctga                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page