(data stored in ACNUC1104 zone)

EMBL: AP008957.PE440

AP008957.PE440       Location/Qualifiers
FT   CDS_pept        complement(490966..491883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31148"
FT                   /db_xref="GOA:C0ZN96"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN96"
FT                   /protein_id="BAH31148.1"
FT                   /translation="MRREDVEFSSDGVTVRGWLYRPDTDEDVPAVVLAGGWCYVRELVM
FT                   PYYAEAFVTAGMAALVFDYRNLGVSDGEPRQHLDPKQQIRDYQNALSFLERTPGIDNDR
FT                   LGAWGISYSGGHVMILAATDPRVKAIVSQIPVIDGFRNMRRIHGTMGYRKLWDAILEDR
FT                   RLRFDDPDQRLHIAHASENPEEELSSWPFPETKTTFAALQATEAPLYQNSSTMESVDLL
FT                   LDYDVNYFVPRILDTPSMMIVAEGDDLTLWDLEIESYNSIPTPKKELVVLPHTSHMTLY
FT                   SDQSKLAVAAEHASRWFTTHLLAK"
     atgcgccgtg aagatgtcga attctccagc gacggagtca ccgtccgcgg ttggctgtac        60
     cgacccgaca ccgacgaaga cgtaccggcc gtcgtactgg caggcggttg gtgctacgtc       120
     cgtgagttgg tcatgcccta ttacgccgag gccttcgtaa cggccggtat ggctgcgctg       180
     gtcttcgact accgcaacct gggcgtgtcg gacggtgaac cccgtcaaca cctggacccg       240
     aagcaacaga ttcgtgatta tcagaacgcg ctcagctttc tcgagcgcac acccggcatc       300
     gacaacgacc gtctcggagc ctggggcatc tcctactccg gcggccacgt aatgattctc       360
     gccgcgaccg atcctcgggt gaaggccatc gtgtctcaga ttccggtgat cgacgggttc       420
     cgcaacatgc gtcggatcca cgggaccatg ggttatcgaa agctgtggga cgcgatcctc       480
     gaagatcgcc gactccgctt cgacgatccg gatcagcgac tgcacatcgc tcacgccagt       540
     gagaatcccg aggaagaact gtcttcctgg ccgttccccg agacgaagac gaccttcgca       600
     gctcttcaag ccaccgaagc tcctctctac caaaacagtt cgactatgga atccgtcgat       660
     ctcctgctcg actacgacgt caactatttc gtgcccagga tcctcgacac accgtcgatg       720
     atgatcgtcg ccgaaggtga cgacctcacg ttgtgggact tggagatcga gagttacaac       780
     agcatcccga ctccgaagaa agaacttgtc gtcctgccgc acacgtcgca catgacgctc       840
     tacagcgacc agtccaagct cgcagtggcg gccgaacacg cttcccgttg gttcacaacg       900
     catctgctgg cgaagtag                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page