(data stored in ACNUC1104 zone)

EMBL: AP008957.PE441

AP008957.PE441       Location/Qualifiers
FT   CDS_pept        491927..492130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31149"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN97"
FT                   /protein_id="BAH31149.1"
FT                   /translation="MRKKTDGLVAVRITASTRFARVNCPERIVADPKYPVIVSHLTAFV
FT                   KCHWTARKIRRYSPAHPLRMYS"
     gtgcgaaaga aaacggacgg tcttgtcgcc gtgcgtatta cggcatcgac gcggttcgct        60
     cgtgtcaact gccccgagcg gatcgtcgcg gatccgaagt accccgtaat cgtgagtcac       120
     ctcacagcct ttgtcaagtg tcactggaca gcaaggaaaa tccgtcggta tagtcctgct       180
     cacccactgc gcatgtattc gtaa                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page