(data stored in ACNUC1104 zone)

EMBL: AP008957.PE443

AP008957.PE443       Location/Qualifiers
FT   CDS_pept        494127..495746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04430"
FT                   /product="putative fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.-"
FT                   /note="protein synonym:acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31151"
FT                   /db_xref="GOA:C0ZN99"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN99"
FT                   /protein_id="BAH31151.1"
FT                   /translation="MLSATRPRAMTGGGVLPEMLLDALRRDPEALALVDESVRWTYQEL
FT                   VDAATSFAGALHKSGFEPGEVVLVQLPNWWESVVAAWGTWLAGGILLPVVPIYRAHELS
FT                   FIIEQAEPSVIVAPQEYRGYRHVEQLGTVLRDLGREVLLVEARGEGGLRRTTFDDFLDF
FT                   GMEANRPDHRADPDDVALVLYTSGTTSAPKGVLHTHRTLMAESSSMIAHCGVDSQDRIF
FT                   MPSPLPHITGMSYAVVLPAAAACSTVLMQRWNPAEAVALIEREQCTFTVSATPFLRGLA
FT                   DAYEEDGYRRSHLTRFVCGGAGIPPELVRRAHRVMGTAVVRTYGSTELPTLVMGDPFGD
FT                   IGLQAEDEGAVIGGNEFRLGEDDELLVRGPELFVGYVDSSINAESFTEDGYFRTGDVAT
FT                   VDGPGQIRITSRIKDIINRGGEKFSAADIEWVLEAHPNVAEVAVVGYPDEELGERACAF
FT                   VVPHGEPPSVRDLRIFLLSEGFAVQKAPERVETVASLPRTESGKVQKFLLRRALGLGSA
FT                   QAVPETYGSEFGHDGNRRKATS"
     gtgctgagcg ctacccgtcc gcgggcaatg accggtggcg gggtgctgcc cgagatgctt        60
     ctcgacgcac tgcgtcgaga tcccgaagca ctggcccttg tcgacgagag tgtgcggtgg       120
     acttaccagg aattggtgga cgctgcaacg agctttgcag gcgcactgca taaatcggga       180
     ttcgagcctg gagaagtggt actcgttcag ctgccgaact ggtgggaatc cgtggttgcg       240
     gcctggggca cgtggcttgc cggcggcatt ctcctgccgg tggtcccgat ttaccgcgca       300
     cacgagctgt ccttcatcat cgagcaagct gagccgtcgg tgatcgtcgc cccgcaggaa       360
     taccgcggat atcgtcacgt cgagcaactc gggactgtgc tccgtgatct gggccgagag       420
     gttcttctgg tggaggctcg aggcgaaggt gggttgcggc gcaccacgtt cgacgacttt       480
     ctggacttcg ggatggaggc gaaccggccc gaccaccgcg cggatcccga cgacgtcgcc       540
     ctcgttctct acacgtcggg aaccacttcg gctccgaaag gcgttctgca cactcatcgg       600
     accctgatgg ccgagagttc gagcatgatc gcgcattgcg gcgtggattc gcaggaccga       660
     atcttcatgc cttcgccgtt gccccacatc accggaatgt cgtatgcggt cgttcttccc       720
     gcagcggcag cctgctcgac ggttctgatg caacgctgga atcccgcgga ggcagttgcg       780
     ttgatcgagc gcgaacaatg cacgttcacc gtgagcgcga caccgtttct ccgcggtctt       840
     gccgacgcct acgaggagga cggatatcga cgatcccatc tgactcgatt cgtgtgtggt       900
     ggggccggga ttccgcccga gctggtacgt cgagcccacc gcgtgatggg gacagcggtt       960
     gttcgtacct acggatcgac ggaacttccg accctcgtga tgggtgatcc tttcggtgac      1020
     atcggtctgc aggccgagga cgaaggagct gtgatcggcg gaaacgagtt ccggctcggc      1080
     gaagacgacg agctgttggt gcgtggtccg gaactgttcg tcggctacgt cgacagctcg      1140
     atcaacgcgg aatcatttac cgaggacggc tatttccgga ctggcgacgt tgccaccgtg      1200
     gacgggccag gtcagatccg gatcacttcg cggatcaagg acatcatcaa ccggggaggg      1260
     gagaaattca gtgctgccga catcgagtgg gtcctcgagg ctcatccgaa tgtggcagag      1320
     gtggcagtgg tcgggtatcc ggacgaggaa ctgggggagc gcgcgtgcgc ctttgtcgtt      1380
     ccgcacggtg aaccaccaag cgttcgagac ctgcggatct tcctgctgtc cgaaggattt      1440
     gctgttcaga aggctccgga gagagtcgag accgttgcgt cgcttcctcg gacggagagt      1500
     gggaaggttc agaagtttct cctgcgtcga gcgttaggct tgggctccgc acaggcggtc      1560
     cccgagacct acggaagcga gttcggacat gacggcaacc ggcgcaaagc cacctcgtaa      1620
//

If you have problems or comments...

PBIL Back to PBIL home page