(data stored in ACNUC1104 zone)

EMBL: AP008957.PE451

AP008957.PE451       Location/Qualifiers
FT   CDS_pept        502642..503154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31159"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNA7"
FT                   /protein_id="BAH31159.1"
FT                   /translation="MRPRREFENVRSRRTTMTRLKVNGKRASRTGVVVASVAVLGMAVA
FT                   PGIAWASNPISDGSPVAVRSIATAPSEAGVAPEVACGAATPISDEELQKLIDEGKVVRA
FT                   EEAGTAAITIEVPGDAATFIAREGVPALPTVESAPAIEGVPAEVLNMAGVAPLEEGVAL
FT                   SCAVAAG"
     atgcgaccgc gccgagaatt cgagaacgtt cgatcaagga gaacaacgat gacgcgattg        60
     aaagtgaacg gcaagcgggc cagccggacc ggtgtggtgg tggcgtcggt ggcggtcctc       120
     ggtatggccg tggcgccggg aatcgcctgg gcttccaacc cgatttccga cgggtcgccg       180
     gtggcggtgc gatcgatcgc gaccgctccg tcagaggcgg gtgtggctcc ggaagtagcg       240
     tgtggtgccg cgacgccgat ttccgacgag gaactgcaga agctcatcga cgagggcaag       300
     gttgtgcgcg ccgaggaggc gggtacagcc gcaatcacga tcgaagtccc tggcgacgcc       360
     gcgacattca ttgcgcgtga aggggtgccg gcgttgccga ccgtcgaatc ggctccggcg       420
     atcgagggtg ttccggcaga ggtgctcaac atggcaggcg tcgctccgct ggaggaaggc       480
     gttgccctgt catgcgcggt tgctgcgggc tga                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page