(data stored in ACNUC1104 zone)

EMBL: AP008957.PE452

AP008957.PE452       Location/Qualifiers
FT   CDS_pept        503306..504178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04520"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31160"
FT                   /db_xref="GOA:C0ZNA8"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNA8"
FT                   /protein_id="BAH31160.1"
FT                   /translation="MCGVLQRVRYGLMRGAFRKVLCFMVMGPTHAMSGAAVGLVVAELL
FT                   PLDWGGPTSTAETLTFAGVCAGAALLPDLDTGQSTVSRSFGPLSKALAKGIDAISVTFY
FT                   RITKGKKDGKRRGGHRTLTHTALFAAGLGAGVSALVVQFGKPAIIITLFFCLGLAIRGL
FT                   AGELAKEKGWLAVSAVALVLSALTWQWYPSEAGSTGLGVAVALGCATHCLGDAITKEGV
FT                   PFLAPLIPLGGKRWWEQRLPSFLSIRAGGSLEKILIGPALTVLTAWLIISAFDGAPEAI
FT                   YAVFAPMVQ"
     gtgtgtggtg tcttgcagag ggtgcggtac ggcctgatgc ggggcgcgtt tcgaaaggtg        60
     ttgtgtttca tggtcatggg ccccacccac gcgatgtccg gtgctgctgt ggggttggtg       120
     gttgcagagt tgttgcctct cgattgggga gggcccacat ccaccgctga aaccttgacc       180
     tttgccggtg tgtgcgcggg agccgccttg cttcccgacc tcgataccgg tcagtcgacg       240
     gtttcccgat cattcggtcc gctcagcaaa gcgctggcca aaggtatcga cgcaatttcg       300
     gtgaccttct accgcatcac caaaggcaag aaggacggca agcgtcgtgg tgggcatcgg       360
     acgctcacgc acaccgcgct gtttgccgcc ggtcttgggg ccggggtctc ggcgctggtt       420
     gttcagttcg ggaagcccgc catcatcatc acgctgttct tctgcctcgg gctggcgatc       480
     cgaggattgg cgggtgaatt ggccaaggag aaggggtggc tcgccgtctc cgctgttgcg       540
     ttggtgctct cggccctcac ctggcagtgg tatccgagtg aggccggatc caccgggcta       600
     ggtgttgcag tggcactggg ctgcgccaca cactgtctcg gcgatgcgat caccaaggaa       660
     ggggtgccgt ttctcgcgcc cctgattccg ctcggcggca agcggtggtg ggaacaacgg       720
     ctgccgtcat ttctgtccat ccgcgcaggt gggagcctcg agaagatcct gatcgggccg       780
     gcgctgacgg tcctgactgc ctggttgatc atcagtgctt tcgacggcgc cccggaagcg       840
     atctacgccg tcttcgctcc gatggtgcag tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page