(data stored in ACNUC1104 zone)

EMBL: AP008957.PE459

AP008957.PE459       Location/Qualifiers
FT   CDS_pept        511894..513312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31167"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNB5"
FT                   /protein_id="BAH31167.1"
FT                   /translation="MCVTGNDAGAGHVFVVRGRLESVDWDAAVVSTSGNFVPREHWWPA
FT                   LGLTSPVERAPAGGNRVRSFPKDGRPAWLLNVASRISVSWLVDGVYEVLDAIASADIRP
FT                   GGRRVKPLVALPTFGVGSGGQGMVRGHVIKALIETAVECADKYDFDIAFVVANAADYAA
FT                   YQSIRRGHLLSAGIPPQVQQLADRLQTGEASLLLGAGVSIPAGLPSWDSLLEAIRQKEL
FT                   PGVSSAEFAELNVLDRAQLLSKELQTEDDGSNDLGERVVQLTGVDIKPTLSHCLLASLR
FT                   VKKVVTTNYDALYERAFESAHGENSVAVLPREEARAGVPWVLKLHGDVADASSIVLSRR
FT                   DFVRYDAERRPLGSIVQSLMATGHLIVVGASMTDDNVLRLAHEVLALDARNKRPRTLGT
FT                   VITLQRDEIRTALWKNDFDYVAVSDSLDQQVAARDLEIFLDKLAILTSVDAPYLLDTHT
FT                   KGCSRGEKSVWQKI"
     gtgtgtgtga ctgggaatga tgcaggtgct ggtcatgttt ttgtcgtccg tggacgtctc        60
     gaatcagtgg actgggatgc ggcggtcgtg tcgacgagcg gcaacttcgt gcctcgtgag       120
     cattggtggc cggcgctcgg cctcacgagt ccagtggaac gtgcaccggc aggtggcaac       180
     agggtgcgct catttccgaa ggatgggcgg ccagcatggc tgttgaatgt tgcttctcgc       240
     atatcggtgt cctggctggt ggacggcgtt tacgaggttc tcgacgcgat cgcatctgcc       300
     gatattcgac ctggaggtcg tcgagtcaaa ccgctcgttg ctttgccgac cttcggggtc       360
     ggctcaggtg ggcaggggat ggttcgtggc catgtcatca aggcgttgat cgagactgcg       420
     gtggaatgtg ctgacaaata cgacttcgac atcgcatttg tagttgccaa tgctgccgat       480
     tacgccgcgt atcaatcgat tcggcggggg catttgttga gtgcaggcat ccctccacag       540
     gtccagcaat tggcagatag gttgcaaact ggtgaagcct ccttgttatt gggtgcggga       600
     gttagcattc ccgccggatt gccgtcatgg gacagcctgc tcgaggcaat tcgtcagaag       660
     gagctgccgg gtgtgagcag cgcggaattt gctgagctca atgtcctcga ccgtgcgcaa       720
     ctgctgtcga aggagttgca aacggaggac gacggatcga acgacctggg cgaacgcgtt       780
     gttcagctga ctggtgttga tatcaaacca acactgtcgc attgtcttct ggcgtctctg       840
     cgagtcaaaa aagtggttac gaccaactac gatgcgttgt acgaacgcgc atttgaatca       900
     gcgcacggcg aaaactcggt cgctgtactt ccgagagaag aagcccgcgc gggggttccg       960
     tgggtactga aattgcacgg tgatgtggct gacgcgtcca gtatcgtctt aagtcgccga      1020
     gacttcgtca gatacgacgc agaacgccgt ccgttgggct cgatcgttca gtcgctcatg      1080
     gcaaccggac atctcatagt tgtcggagca tctatgaccg atgacaatgt gctccggctt      1140
     gcacatgaag tattggcact cgatgcacgg aacaagcgcc cacgaacttt gggcaccgta      1200
     atcacactgc agcgggacga gattcgaact gccttgtgga agaacgactt cgactacgtt      1260
     gccgtttcgg attccctgga tcagcaagtg gctgcgcgtg acctcgagat atttctggac      1320
     aagctcgcga tcttgacgag tgtcgacgct ccgtacttgt tggatacgca tacaaagggc      1380
     tgctcgaggg gggagaaatc ggtttggcag aaaatctga                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page