(data stored in ACNUC1104 zone)

EMBL: AP008957.PE46

AP008957.PE46        Location/Qualifiers
FT   CDS_pept        55371..56867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30754"
FT                   /db_xref="GOA:C0ZLI6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLI6"
FT                   /protein_id="BAH30754.1"
FT                   /translation="MLQRLRGDWSGRGQVLLKTKSTQTGSRRDIWRLTPDAGSLLEEKK
FT                   KADDKGAVRIVDLALWFGRNLDIDSVTPNAVGGLDGSVHDIDRLIFWFKQKFGLPAGDL
FT                   VGTLYSDDVPAEYRETQFEAEPVGEDTLELLGSLPPAPTVGMNLGELVVLLEQSLEKGG
FT                   YQLPPGLVRRVLTAWLRGDIVILVGQPGTGKTLFATLLAGEMASLLQLDSPITVAVRAD
FT                   FDETEFIGYERLDGTPELRQFAQDVLMTENPLEAKIVVLEEFNLAAIETYLASVLVATQ
FT                   EQTRQIQLPGGTTGKLPVDTFVLATCNSFRDEPETRMRISSPTKRRSTIITMPNVLGDR
FT                   FDEDPGNAVLSLVSGLVGVESNRVAKRQADSRPSQFDSLRGAALTTVKTLDDLSDGVKK
FT                   HLVDVSGAILGTSTGRSWFTMGLLRDVVLAITHADRSESAELLALGEAVADKLIHQVRG
FT                   THSDIEELREVCANLPNAGEIATMIDRMMDGPSDELLPLL"
     gtgttgcaac ggcttcgtgg ggactggagt ggtaggggtc aggttcttct caaaacaaag        60
     tcgacacaga ccggttcacg tcgagatatc tggcgactga cccctgatgc cggcagcctt       120
     ctggaggaga agaagaaagc cgatgacaag ggagcagtga gaattgttga tctcgctttg       180
     tggtttggcc gtaaccttga cattgacagc gtgactccga atgcagttgg ggggctcgac       240
     ggatcggttc acgacatcga tcggcttatc ttctggttca agcaaaagtt cgggttgccg       300
     gctggggatt tagtaggaac tctttacagc gacgacgttc ctgcggagta tcgagagact       360
     caattcgagg cggagccggt tggcgaagac acgcttgagc ttctgggtag tttgcctccc       420
     gcgcccacgg tcggcatgaa cctcggcgaa ctcgtggtcc tccttgaaca gagccttgag       480
     aagggcggtt accaattgcc gcccggtctt gttcgccggg tgctaaccgc ctggttgaga       540
     ggtgacatcg tcattctcgt cggacaaccg gggactggaa agacgctctt cgcgactctg       600
     cttgcgggtg aaatggcctc cctacttcaa ctggattcac ccatcaccgt cgctgtacgc       660
     gccgatttcg acgagaccga gttcatcggg tacgagcgat tggacggcac tccggagcta       720
     cgtcagttcg cgcaggatgt tttgatgacg gagaatccgc tggaagcgaa aatagtcgtg       780
     cttgaggaat ttaacctcgc ggccatcgag acgtatctgg cctccgtctt ggtagcgacc       840
     caggagcaga cccgacaaat acaactgcca ggcgggacga ccggaaagtt gccagtcgat       900
     acgtttgtgc tcgctacttg caactccttt cgtgacgagc cggagacgcg gatgcgaatc       960
     agctctccca ccaaacgtcg atccacgatc atcacaatgc cgaatgtcct tggagaccgt      1020
     tttgacgaag atccaggtaa cgccgtatta agtctggttt caggtttggt aggcgtcgaa      1080
     tcaaaccggg tggccaagcg tcaagccgat tctcggccat cccagttcga cagtctccgg      1140
     ggagccgcac tgacgactgt caagacactt gatgatttgt cagacggggt aaagaagcac      1200
     ctagtggacg tgagcggggc gattctgggt acttcgacag gtcgctcctg gttcaccatg      1260
     ggtctcctcc gcgacgtagt acttgcaatc acacacgccg atcgcagcga atcggcggaa      1320
     ctacttgctc taggagaggc ggtggcagac aagctgatcc atcaagttcg aggcactcat      1380
     tcggacatcg aagaacttcg tgaagtctgc gccaatctcc ccaacgccgg tgagatcgcc      1440
     accatgatcg atcgtatgat ggacggtcct tctgacgagc tgctaccact cctctaa         1497
//

If you have problems or comments...

PBIL Back to PBIL home page