(data stored in ACNUC1104 zone)

EMBL: AP008957.PE460

AP008957.PE460       Location/Qualifiers
FT   CDS_pept        complement(513525..513848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31168"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNB6"
FT                   /protein_id="BAH31168.1"
FT                   /translation="MASQPDFAHNDMASRSRREKAVGLAKFAWDRDISSAELLEMPDDR
FT                   LRKLARAAGANPPSTRETWTIAAGLLDEKAVWAAANPDRPEARREHPDEKIMWVKKPIE
FT                   PWL"
     gtggcatccc aaccagactt tgcgcacaac gacatggcga gccgtagccg acgcgagaaa        60
     gccgtcggcc tggccaagtt cgcctgggat cgcgatatca gtagcgcaga gttgctcgag       120
     atgcccgacg atcggctgcg caaactcgca cgtgcggccg gcgccaatcc gccgagcacg       180
     cgggagacct ggaccatcgc ggccggactg ctcgacgaga aagctgtgtg ggcagccgct       240
     aaccctgacc gtcccgaagc tcggcgtgag catccggacg agaagatcat gtgggtgaag       300
     aagccgatcg agccgtggct gtga                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page