(data stored in ACNUC1104 zone)

EMBL: AP008957.PE462

AP008957.PE462       Location/Qualifiers
FT   CDS_pept        515152..515628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31170"
FT                   /db_xref="GOA:C0ZNB8"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNB8"
FT                   /protein_id="BAH31170.1"
FT                   /translation="MSDTTPSLKATLRTDMVASMKAKDPLRTATLRMLMAAIQTEEVAG
FT                   KEARVLTDEEIIKVLAKESKKRGESAEIYTENGRGELAAKERAEAQIIDEYLPTPLTDA
FT                   ELVDVVDTALAQVSEELGERPGMRQMGQVIKAASALAKGKADGARISAAVKSRL"
     atgtccgaca cgacaccatc gctcaaagcc accctccgaa ccgacatggt tgcatccatg        60
     aaggcgaagg atccgctacg tacagccacc cttcggatgc tcatggcagc catccagacc       120
     gaagaggtgg ccggtaagga agcgcgcgtc ctcaccgacg aagaaatcat caaagtcctt       180
     gcaaaggaat cgaagaagcg tggcgaatcg gccgagatct acaccgagaa cggccgcggt       240
     gagcttgccg cgaaagagcg cgccgaagct cagatcatcg acgagtacct gccgacgccg       300
     ttgaccgacg ccgagcttgt cgacgtcgtc gacaccgccc tcgctcaggt gtccgaggag       360
     ctcggtgagc gtccggggat gcgccagatg ggccaggtca tcaaggccgc cagcgcgctg       420
     gccaagggca aggccgatgg cgcacgtatc tctgcagcag tgaagtcccg cctgtag          477
//

If you have problems or comments...

PBIL Back to PBIL home page