(data stored in ACNUC1104 zone)

EMBL: AP008957.PE47

AP008957.PE47        Location/Qualifiers
FT   CDS_pept        complement(56864..58381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30755"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLI7"
FT                   /protein_id="BAH30755.1"
FT                   /translation="MTFECSAFGAPSFPKSGSQIPPNLVLGDADHMKKLNVRLISGVRE
FT                   WELGDLPRIVPAGQIVLAVRGNGSSTILLDGHRTRLTSGLVGIDLTRSTGYHRLDIEGR
FT                   TFWFGTQDAKLQLDGIEAMLNELGNQGTGWGGQVLFSDGAGLRNPHVVYGWLDEWAEST
FT                   LTAVESVLASPRPRTTRSEVLSRRGGSGVLRAPTLRLLRSAPKQYLSPDPNGALQMSDG
FT                   SRYTPLRVVVRKRSTSLDTIANRRAVALLTWLIRLNEEVLENKPSNTARVRCRLWLNRA
FT                   QTLARRPLAQALRSVGPGIEQSRQAEETTDAPYRMCYAATTDLRRLFAWSATSKPLGRY
FT                   SYVDRSDEIYQAYAASRLAKELGMQQTHPVLGSERLAFTGERFDMYYDTTSPPSVLRSW
FT                   RAQSLRPDDSRPDLLIHEKATGRVAVLDAKYRVARDGGASEDSRKEVTAYLGLYGISSI
FT                   SILFPGDGDAVTVSGHGRSIHEIPLRPGSDLSAAVPLILGSFSLPPF"
     gtgaccttcg agtgctcggc attcggcgca ccttcattcc cgaagtccgg gtcgcagata        60
     ccacccaatc tcgtattggg agatgctgat cacatgaaaa agttgaacgt gcggctgata       120
     agtggggtcc gggagtggga gttgggtgat ctgcctcgga ttgtcccagc agggcagatc       180
     gtattggctg tcaggggaaa cggaagcagc acgatcctgc ttgacggtca ccgtactcgc       240
     ctgacaagcg gtctcgtcgg tatagacctc accagatcga ccggctacca ccgtctcgat       300
     atcgagggta ggacgttctg gttcgggacg caggacgcca aacttcaact agacggtata       360
     gaggccatgc ttaacgaact gggaaaccaa gggactggat ggggcggcca ggtgttgttc       420
     tctgatggag ctgggctgcg caatcctcat gtcgtgtatg gctggctcga cgagtgggca       480
     gaatcaactt tgacagcagt ggagagtgtt ttggcgtctc cacgacctag gaccactcgg       540
     tctgaggtac tcagccgacg aggtggttcg ggcgtgcttc gcgcccccac tttgaggctg       600
     ctgcgctcag ccccaaaaca atacttgtcg ccggatccca atggggcact acagatgtca       660
     gacggttctc gatacacgcc tttgagggtg gtcgttagga agaggtcgac gtctctcgac       720
     acgattgcga atcggcgtgc agtcgcgctt ctcacgtggc tgattcgtct gaatgaagag       780
     gtccttgaga acaagccatc gaacacggca agggtgcgtt gtcgtctctg gctcaatcgg       840
     gctcaaactc tcgccagacg tcccctcgct caagcccttc gcagtgtcgg cccaggcatc       900
     gagcaatcac ggcaggccga ggagacaact gacgctccat atcgaatgtg ctatgccgct       960
     acaaccgatc ttagacggct gttcgcatgg tctgcgacct cgaagcctct cgggcggtat      1020
     agctatgtcg acagatcaga cgagatttac caggcttatg cggcctcccg gctagccaag      1080
     gagcttggga tgcagcagac ccatcctgtc cttgggtctg aacgtctcgc gttcacgggc      1140
     gagcgcttcg acatgtacta cgacacaact tccccaccgt cagtactgcg atcttggaga      1200
     gcacagagtt tgaggcccga tgactccagg cctgacctac tgatccacga gaaggcgaca      1260
     ggccgcgtcg cggttctcga cgcgaagtat cgggtcgcac gcgatggcgg agcctcggaa      1320
     gacagcagaa aagaagtgac ggcatatctg ggtctatacg gcatctcgtc gatatcgatc      1380
     ctctttcctg gtgacggtga cgccgtcacg gtcagcgggc atggcagatc aattcatgag      1440
     ataccacttc gtccgggctc tgatctatca gctgctgtac cgctgatttt gggatcattt      1500
     tcgctccccc cattttag                                                    1518
//

If you have problems or comments...

PBIL Back to PBIL home page