(data stored in ACNUC1104 zone)

EMBL: AP008957.PE484

AP008957.PE484       Location/Qualifiers
FT   CDS_pept        534811..535425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04840"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31192"
FT                   /db_xref="GOA:C0ZNE0"
FT                   /db_xref="InterPro:IPR000059"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNE0"
FT                   /protein_id="BAH31192.1"
FT                   /translation="MTRPAAVLVLFGGPREADPLAVGGLPEGADVLLTQRASTMRQHSG
FT                   QVAFPGGAADPGDDGPIGTALREAQEETGLDPSGVQPLTVLPEIFIPPSGFDVTPVLGY
FT                   WEQPTTVGIQDEGEVGRVARVPLRTLLDPDNRFQVRHPLGYQGPAFRADGMLVWGFTAG
FT                   ILAALFTVSGWEIPWNYEDVRDLDTALSEFGEGVEDSAVPR"
     gtgacgcgtc cggccgcggt gctcgtgctc ttcggcggac cgcgtgaggc agaccctctc        60
     gccgtcggcg gcttgccgga gggcgcagac gtgttgctga cccaacgggc gtcgacgatg       120
     cgtcagcaca gcggacaggt cgcatttccg ggcggcgccg ctgatccggg cgacgacggc       180
     cccatcggca ccgcgctgcg tgaagcgcag gaggagaccg ggctcgatcc gagcggagtt       240
     cagccgctca ccgtgctgcc ggagatcttc atcccgccgt cgggtttcga cgtgacgccg       300
     gtgctcggct actgggagca gccgacgacg gtggggattc aggacgaggg cgaggtcgga       360
     cgggtggcca gggtgccgct gcgcacgttg ctcgaccccg acaaccggtt tcaggttcgc       420
     catcccctcg gataccaggg cccggcgttc cgcgccgacg gcatgctggt ctgggggttc       480
     acagcaggaa tcctcgcggc gctgttcaca gtgtcgggct gggagattcc gtggaactac       540
     gaggacgtga gagacctgga cacagcgctg tccgagttcg gtgaaggtgt cgaggattcg       600
     gcggtgccgc gatga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page