(data stored in ACNUC1104 zone)

EMBL: AP008957.PE485

AP008957.PE485       Location/Qualifiers
FT   CDS_pept        535422..536612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04850"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31193"
FT                   /db_xref="GOA:C0ZNE1"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNE1"
FT                   /protein_id="BAH31193.1"
FT                   /translation="MTGSRWVDIAIVLVALIAATSGWRQGAVASALAFVGVILGAVAGI
FT                   LLAPHLLVHVTEGKLRILAGISLIVVLVIIGEVAGMVLGRAARSGMHSPTARSVDSVIG
FT                   AGLQAVAVVVAAWLLAIPLTSSSQPNIAAAVRGSDVLASVDELAPQWLRRIPTEFSALL
FT                   DTSGLPDVIGPFGRTPITEVEAPDASVLASPLAAQLRPSVLRINGVAPSCQRALEGSGF
FT                   IVAPERVMTNAHVVAGTESITVDTMEGALPAQVVLFDSAVDIAILAVPGLDAPVLPFAP
FT                   EQAQTGDNALVLGYPGGGPYTASAARVREVLNLNGPDIYKAGTTQREVYTVRGSIRQGN
FT                   SGGPMVDDQGRVLGVVFGAAVDDSDTGFVLTAQEVSRQLNAAASASTPVPTGACIL"
     atgacaggtt ctcgttgggt ggacatcgcc atcgttctgg tcgccctcat cgcggccacg        60
     tccggatggc gtcagggcgc ggtggcgtcg gcgttggcgt ttgtcggcgt gatcctcggt       120
     gccgtcgccg gaattctgtt ggcgccacac ctgctcgtgc acgtcaccga aggcaagctg       180
     cgcatcctcg cgggcatctc gctgatcgtg gtgttggtca tcatcggcga agtcgccggc       240
     atggtgctcg gacgcgcggc gcgcagcgga atgcacagtc cgacggcgcg atccgtcgac       300
     agcgtcatcg gtgcgggtct acaggcggtg gccgtcgtgg tcgcggcgtg gttgctcgcg       360
     attccgctca cttcttcgtc gcagccgaat attgccgccg ctgttcgtgg ttcggatgtt       420
     ctcgccagcg tggacgaact ggcgccgcag tggctgcgcc gcatcccgac ggagttttcg       480
     gcgttgctcg acacctccgg cctgccggac gtcatcggcc cgttcgggcg tacgcccatc       540
     accgaggtcg aagcacccga cgcgagcgtt ctggccagtc cgttggcggc gcagttgcgt       600
     ccgagtgttc tacgcatcaa cggcgtcgca ccgagttgcc agcgcgcgct cgagggatcc       660
     ggattcatcg tcgcccccga acgcgtcatg accaacgcac acgtggttgc cggaaccgag       720
     agcatcacgg tggacaccat ggagggcgcg ctgcccgcgc aggtggttct cttcgactcc       780
     gccgtcgaca tcgcgattct ggcggttccc ggactggacg caccggtgct gccgtttgct       840
     ccggagcagg ctcagaccgg cgacaacgcg ttggtgctcg gttaccccgg cggcggtccg       900
     tacacggcca gcgcagcccg cgttcgtgag gtcctgaacc tgaacggacc ggacatctac       960
     aaggccggaa ccactcaacg tgaggtctac accgtccgcg gatccatcag gcagggcaac      1020
     tctggtgggc cgatggtcga cgatcagggg cgcgtcctcg gcgtcgtgtt cggtgccgcc      1080
     gtcgacgaca gcgacaccgg attcgtcctc accgcccaag aagtatcgcg ccagttgaac      1140
     gcggctgcct cggcgtcgac gccggtgccg acaggcgcct gcattctgta g               1191
//

If you have problems or comments...

PBIL Back to PBIL home page