(data stored in ACNUC1104 zone)

EMBL: AP008957.PE490

AP008957.PE490       Location/Qualifiers
FT   CDS_pept        complement(541028..542713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04900"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31198"
FT                   /db_xref="GOA:C0ZNE6"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNE6"
FT                   /protein_id="BAH31198.1"
FT                   /translation="MTAVNEQVSAGAPDRADLGENAALKETLEDYTLRFAPRSYRKWGT
FT                   GVVATSALGGIAYLADFSIGANIGISYGTGNALLGIAVFAVVIMATGFPLAYYAARYNI
FT                   DLDLITRGSGFGYYGSVVTNVIFATFTFIFFALEGSIMAQGLKLGLGIPLSIGYAVSTL
FT                   MVIPLVIYGMKALAKLQVWTTPLWLVMMVLPFLYLLFKHPDSVSAFFAFGGEDGANGKG
FT                   VNFGSVMLAAGVCLSLIAQIAEQIDYLRFMPPKTPENTRRWWAAVILAGPGWVIFGAFK
FT                   QIVGLFLAVYIIANVVDGSSIANQPVHQFLEIYQDMMPHWLAMTLAVILVVISQIKINV
FT                   TNAYSGSLAWTNSYTRVTKTYPGRMIFVLVNLAIALILMEANMFDFLNTILGFYANCGI
FT                   AWVVVVASDIAINKYWLKLSPKVPEFRRGMLYDVNPVGFVSMLLAAGISILVFFGAFGS
FT                   AIKPFSPIVAIVIALVMPPVLAVATKGKYYLRRTDDGIDLPMFDEYGNPSGETLLCCVS
FT                   GIEFERPDMLASNVPGPNGEKQYISSLALSTDKTGEHVLPAQLP"
     atgacagcag tgaacgagca ggtgtccgcc ggcgcaccgg acagggcaga tctcggtgag        60
     aacgccgcac tgaaggagac tctggaggac tacaccctcc gatttgcgcc acgcagctac       120
     cgcaaatggg gaaccggcgt cgtcgcgacc tccgcgctcg gcggaatcgc gtatctcgca       180
     gacttctcga tcggcgccaa catcggcatc tcgtacggca ccggtaacgc attgctgggc       240
     atcgccgtgt ttgccgtcgt catcatggcc accggcttcc cactcgccta ctacgccgcg       300
     cgatacaaca tcgacctcga tttgatcacg cgcggaagcg gtttcggcta ctacggctcc       360
     gtggtcacca acgtcatctt cgcgacgttc accttcatct tcttcgcgct cgaaggttcc       420
     atcatggccc agggtttgaa actggggctc gggatcccac tctcgatcgg ctacgcggtc       480
     tcgaccctga tggtcattcc actggtcatc tacggaatga aggctctggc aaagctccaa       540
     gtgtggacga cgcctctgtg gctcgtcatg atggtgctgc cgttcctgta tctgctgttc       600
     aagcacccag attcggtgag cgcgttcttc gccttcggcg gtgaggacgg cgcaaacggc       660
     aagggcgtca acttcggatc ggtgatgctg gccgcgggtg tctgcctgtc gctgatcgca       720
     cagatcgccg agcagatcga ctacctacgc ttcatgccgc ccaagacgcc ggagaacacc       780
     cgtcgttggt gggctgcagt aattctcgcg gggcccggct gggtcatctt cggcgcgttc       840
     aagcagatcg tcggactgtt cctcgccgtg tacatcatcg cgaacgtcgt cgacggatct       900
     tcgatcgcca accagcccgt gcaccagttc ctcgagatct accaggacat gatgccgcac       960
     tggctggcca tgacccttgc cgtgatcctc gtggtcatca gccagatcaa gatcaacgtc      1020
     accaacgcgt actccggctc actggcctgg accaactcgt acacccgcgt caccaagacc      1080
     tatccgggac gcatgatctt cgttctggtc aacctggcga tcgcactgat cttgatggaa      1140
     gccaacatgt tcgacttcct caacacgatc ctgggcttct acgccaactg cggtatcgcc      1200
     tgggtcgtgg tcgtcgcctc ggacatcgcg atcaacaagt actggttgaa gctctccccg      1260
     aaggtccccg agttccgacg cggaatgctc tacgacgtca accccgtcgg cttcgtgtcg      1320
     atgctgctgg ccgcgggtat ttcgatcctg gtgttcttcg gtgctttcgg ttcggcgatc      1380
     aagccgttct ccccgatcgt cgcgatcgtc atcgcactgg tgatgccgcc ggtcctcgcc      1440
     gtcgccacca agggcaagta ctacctgcgg cgcaccgacg acggcatcga cctgccgatg      1500
     ttcgacgagt acgggaaccc ctccggcgaa acgcttctgt gctgcgtcag cgggatcgag      1560
     ttcgagcgac ccgacatgct cgcgtcgaac gttcccggcc cgaacggcga gaagcagtac      1620
     atcagttcct tggccttgag caccgacaag accggtgagc acgtcctgcc tgctcagctt      1680
     ccctga                                                                 1686
//

If you have problems or comments...

PBIL Back to PBIL home page