(data stored in ACNUC1104 zone)

EMBL: AP008957.PE499

AP008957.PE499       Location/Qualifiers
FT   CDS_pept        552320..553276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_04990"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_04990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31207"
FT                   /db_xref="GOA:C0ZNF5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNF5"
FT                   /protein_id="BAH31207.1"
FT                   /translation="MSETVKTGRAVRQSHFVAPPEVAAPGETDAVKLDQAPTSMWTDAW
FT                   RDLRKRPLFIISTIIILAVIVIAAFPSLFTSTDPRFCDLTYSMQGPTSGHWFGFDRQGC
FT                   DVYSRTIYGARASVLVGVGVTASVLVIGVIFGALSGFYGGWTDSILSRVADIFFGIPLI
FT                   LAAIVLMQLFTDRTIWTVVGVLALFGWPQMARIARGAVISAKNNDYVMASEALGVSKLK
FT                   TLIRHVIPNSLAPIIVVATISLGTYIVAEATLSFLGIGLPSTEVSWGGDISNAQVTLRQ
FT                   GSTILFYPATALAITVLGFIMMGDALRDALDPKSRKR"
     atgtctgaga ccgtgaagac cggacgcgca gtccggcaaa gtcatttcgt ggcaccgccc        60
     gaagttgcgg caccggggga gacggacgcc gtcaaactcg atcaggcgcc gacgagcatg       120
     tggaccgatg cgtggcgcga cctacgcaag cgccccctgt tcatcatctc gacgatcatc       180
     atcctcgcgg tcatcgtcat cgcagcgttt ccgagcttgt tcacgagcac cgatccgcgg       240
     ttctgcgacc tgacctacag catgcagggg ccgacctcag ggcactggtt cggtttcgac       300
     cgccagggct gtgacgtgta ctcgcgcacc atctacggtg ctcgcgcatc cgtactcgtg       360
     ggcgtcggtg tcacggcgtc ggtgctggtg atcggcgtga tcttcggtgc gctgtccggt       420
     ttctacggcg gatggaccga ttcgatcctc tcccgtgtcg ccgacatctt cttcggcatc       480
     ccgctgatcc tggctgccat cgtcctgatg cagctgttca ccgatcgcac catctggacc       540
     gtcgtcggcg tgctggcgct cttcggctgg ccgcagatgg caagaatcgc tcgaggcgcg       600
     gtgatctcgg cgaagaacaa cgattacgtc atggcctcgg aagcgttggg tgtctcgaag       660
     ctcaagacac tgatccgcca cgtcatcccg aactcgttgg cgcccatcat cgtggtcgcc       720
     accatctcgc tcggtacgta catcgttgcc gaggcgacgc tgtccttcct cggtatcggt       780
     cttccgtcca ccgaggtttc gtggggcggc gacatcagca acgctcaggt gacgctgcgt       840
     cagggttcga ccattctgtt ctacccggca acggctttgg cgatcaccgt tctcggattc       900
     atcatgatgg gtgacgctct gcgcgacgcc ctcgatccca agtcgcggaa gcggtga          957
//

If you have problems or comments...

PBIL Back to PBIL home page