(data stored in ACNUC1104 zone)

EMBL: AP008957.PE5

AP008957.PE5         Location/Qualifiers
FT   CDS_pept        6276..6821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00050"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30713"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="InterPro:IPR023007"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLE5"
FT                   /protein_id="BAH30713.1"
FT                   /translation="MTEDSSAAPEPELKGIDLARRALEEARATAKANGKAVGQGRSSPK
FT                   YGSGRPRRRSGWSGPGPDARDPQPFGALTSAISKSRGWSPKVSEGTVLGRWPQVVGEDI
FT                   SAHAEPISLKEGVLSISAESTAWATQLRMMQSQILAKIAAAVGDGVVKTLRITGPSAPS
FT                   WRKGERHVKGRGPRDTYG"
     atgactgaag acagcagcgc ggccccggag cccgagctca aggggatcga tctggcgcgc        60
     cgtgccctcg aggaggcacg cgcgacagcc aaagccaacg gcaaggccgt cgggcagggg       120
     cgctcgtcgc ccaaatacgg aagtggccgc ccgcgtcgac gcagcggttg gtccggcccc       180
     ggcccggatg cgcgggaccc tcagccgttc ggtgctctca ccagcgctat ctccaagtcg       240
     cgtgggtggt cccccaaggt gtccgagggc acggtcctcg gtcggtggcc gcaggtcgtc       300
     ggagaagaca tctccgcgca cgccgagccg atctctctga aagaaggtgt tctcagcatc       360
     tccgccgagt cgacggcttg ggctacccag ttgcgcatga tgcagtccca gattctggcc       420
     aagatcgctg ctgccgtcgg tgacggcgtc gtgaagacac tgcgcatcac cggtccgagt       480
     gcgcctagct ggcgcaaggg tgaaaggcat gtgaaaggcc gcggacctcg cgatacgtac       540
     ggctga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page