(data stored in ACNUC1104 zone)

EMBL: AP008957.PE50

AP008957.PE50        Location/Qualifiers
FT   CDS_pept        complement(60440..61879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30758"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLJ0"
FT                   /protein_id="BAH30758.1"
FT                   /translation="MTTAVVVGSGPNGLAAAIELARAGIDVHVIEGADKIGGGTRSSEY
FT                   IVDGLVHDDCSAFHPTALASPYFKELDREFGLAEHGLTWRWPEIDLVHPLDDGTAGVLW
FT                   RDINRTAEGLGVDGKRWLDVFGYLAENFDELVQDVFQPIVHVPKHPLMLARFGTGALLP
FT                   ATGFARMFKTPQARALFGGVAAHMFGTLTLPLSSAVGSMLTAGAHAHGWPVAQGGSGSI
FT                   AAALASILRSLGGTIETGNWVTNYSQIADYDIVMLDIAPDAAGRLLDGRQPDRIARAYR
FT                   KFRYGTAAYKVDYAVRGDSDGSVVPWTNPHARKAGTLHLSGTISETAAVERQTVRGQMP
FT                   DKPFILLGQQFLADPSRSVGDIHPVWAYAHVPHGYPGDATDVVTRQIERFAPGFRERIV
FT                   GVHVRNVPQMQEYNPNYVGGDISAGANTARQIIARPRFGLDPYATGAPGVYLCSSATPP
FT                   GGGVHGMGGFNAARAALKARG"
     atgacaacag cagtagtggt gggcagtggc cccaacggtc tcgcggcggc gatcgaactc        60
     gcccgcgccg gaatcgacgt ccatgtcatc gagggtgcgg acaagatcgg cggcggtacc       120
     cgcagtagcg aatacatagt cgacggactc gtccacgacg attgctccgc cttccatccc       180
     accgctttgg cttctccata cttcaaggaa ctcgaccgcg aattcggact cgccgagcat       240
     ggcctgacgt ggcggtggcc cgagatcgat ctggtccatc cactcgacga cggcaccgcc       300
     ggggttctct ggcgcgacat caaccggacc gctgagggac tgggtgtcga cggtaagcgc       360
     tggctcgacg tcttcggata cctcgccgag aacttcgacg agttggtgca ggacgtcttc       420
     cagccgatcg tgcacgttcc gaagcacccg ctgatgctcg cgcgtttcgg gacgggcgct       480
     ctgcttcccg cgacgggctt cgctcggatg ttcaagaccc cacaggcccg ggcgctgttc       540
     ggtggcgtcg cggcgcacat gttcgggacg ctgacccttc cactctccag tgctgtcggt       600
     tcgatgctca ctgctggagc ccatgctcac gggtggcctg tggcacaagg tggttcgggc       660
     tcaattgcag ctgccctcgc ctcgatcctg cgcagcctcg gtggcacgat cgaaaccggg       720
     aactgggtca ccaactactc ccagatcgcc gattacgaca tcgtcatgct cgatatcgcc       780
     cccgacgcgg ccggtcgtct gctcgacggc cggcagcccg accgcattgc acgggcctac       840
     cgcaaattcc gctacggcac cgccgcgtac aaggtcgact acgccgtgcg tggtgattcc       900
     gacgggagcg tcgtgccgtg gacgaatccg catgcccgga aggccggcac cctgcatctg       960
     tccgggacga tttcggagac tgctgctgtc gaacgtcaga ccgttcgggg tcagatgccg      1020
     gacaagccct tcattctgtt gggccagcag ttcttggccg acccttcccg ttccgtcgga      1080
     gatatccatc ccgtgtgggc gtatgcgcat gtgccgcacg gctatccggg tgacgcaacc      1140
     gatgtggtca cgcgtcagat cgaacgcttt gcgccgggat tccgggagcg gatcgtgggc      1200
     gtccacgtgc gcaatgtgcc gcagatgcag gagtacaacc ccaactacgt gggtggcgac      1260
     atctccgctg gggcgaacac tgcgcggcag atcatcgcgc gcccccggtt cgggctcgac      1320
     ccctatgcca ccggcgcccc gggcgtctac ctctgctcgt ccgcaactcc cccgggcggc      1380
     ggggtccacg ggatgggtgg gttcaatgct gcgcgggcgg cgctgaaggc gcggggttga      1440
//

If you have problems or comments...

PBIL Back to PBIL home page