(data stored in ACNUC1104 zone)

EMBL: AP008957.PE501

AP008957.PE501       Location/Qualifiers
FT   CDS_pept        555063..555812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31209"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNF7"
FT                   /protein_id="BAH31209.1"
FT                   /translation="MTDPLQPLVDLPGVRAAADHARDALGEVHRHKTNRRGWPTTAAEA
FT                   AVRAARASASLAGGTTELPAEGMAGDPILAGALRVAQALDGDSLPLMESTWKRAPLQAL
FT                   ARLHLLAAADLVEDADQLGRPRSDRGVGERLDALAQLVTGGTSAPAPVLAAVVHGELLA
FT                   LSPFGTADGIVARAASRLVAVSSGLDPHNLGVPEVSWLRRPQAYTDGAAGFASGNPAGV
FT                   GSWVILCCGALEAGAREATSIADAATG"
     gtgacggacc ccttgcagcc cctcgtcgat cttccaggcg tacgcgccgc cgccgatcat        60
     gcgcgcgacg ctctgggtga ggttcatcgg cacaagacca accgtcgcgg ttggcccacc       120
     actgccgccg aagccgcggt tcgcgctgcg cgagcttccg catcgctggc cggtggcacc       180
     accgaattgc cggccgaggg catggccggt gatccgattc tcgcgggtgc tctgcgcgtg       240
     gctcaggctc tggacggcga cagtcttccg ctcatggagt cgacgtggaa gcgcgccccg       300
     ctgcaggctt tggcccggct gcacctgctg gccgcggcag acctcgtcga ggacgcggat       360
     caactgggac ggccacggtc ggatcgcgga gtgggggagc ggttggacgc tctcgcacaa       420
     ctcgttaccg gcggaaccag tgcgccggcg ccggttctgg cggccgtcgt acacggagaa       480
     ctcttggcgc tgagcccgtt cggcaccgct gacggcatcg ttgcacgtgc ggcttcgcgt       540
     ctggttgcgg tctcgtccgg gttggatccg cacaatctgg gagtccccga ggtcagttgg       600
     cttcggcggc cgcaggcgta cacggacggc gcggctggat tcgcttcggg aaatccggcg       660
     ggtgtcggca gttgggtgat cttgtgctgc ggagctctcg aagccggtgc gcgagaagcg       720
     acttcgatcg ccgacgcggc gactggatag                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page