(data stored in ACNUC1104 zone)

EMBL: AP008957.PE506

AP008957.PE506       Location/Qualifiers
FT   CDS_pept        560388..560972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31214"
FT                   /db_xref="GOA:C0ZNG2"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNG2"
FT                   /protein_id="BAH31214.1"
FT                   /translation="MSWASVAMIALALAIIPARRGASARAAEILFADTTTENSVAAPDK
FT                   PDPLAVAASLDLLGACLRAGLPVSAAITAMASTAPKPMADTLSRVADLLTLGADPDAAW
FT                   SEAALDPDTEALARMARRSARSGSSLSSSMAELAERSRGDAEDLAAAAAERAGVLISGP
FT                   LGLCFLPAFIALGIVPVVIGLATTVLGNGLL"
     ttgagttggg catccgtggc gatgatcgcg ttggcgctcg cgatcattcc cgctcgccgc        60
     ggcgcttcgg ccagggcggc agaaattctg ttcgcggaca caacaacaga aaattcggtt       120
     gcagccccgg acaagccgga tccactcgca gttgccgcaa gtctcgacct gctcggggcc       180
     tgcctgcgag cggggcttcc cgtctccgcc gcgatcacag cgatggcgtc gacggcaccg       240
     aaaccgatgg ccgacaccct cagtcgcgtc gccgaccttc tcacgctcgg tgctgatccc       300
     gacgccgcgt ggagcgaagc cgctctcgat cccgataccg aggcgctggc cagaatggct       360
     cggcgttccg cccgttcggg ttcgtcgctg tcctcgtcca tggcagaact cgccgagcgc       420
     agtcgaggtg acgccgagga tctggctgct gccgcggccg aacgtgcggg agtgctgatc       480
     agcggtccac tcggactgtg tttcctgccg gcgttcatcg ccttgggcat cgtcccggtg       540
     gtgatcgggc ttgccacgac tgtgctcggt aacggcctgt tgtga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page