(data stored in ACNUC1104 zone)

EMBL: AP008957.PE516

AP008957.PE516       Location/Qualifiers
FT   CDS_pept        570899..571330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05160"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31224"
FT                   /db_xref="GOA:C0ZNH2"
FT                   /db_xref="InterPro:IPR021215"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNH2"
FT                   /protein_id="BAH31224.1"
FT                   /translation="MGVMELEVVASRRRALAAPVGVAAVAVTAAAVLHFRDPHSAGSYG
FT                   VCPMYALTGLWCPACGGLRAVNDLTNLDVGAAVSSNVLIVPFVAVLVIAWIGWTVRRWK
FT                   GTRDRMIVLRPTVTIVVLGVLVAFTVVRNTPWGSWLAPA"
     gtgggtgtca tggagttgga agtggtcgca agtcgacgac gcgcgctggc cgcacccgtc        60
     ggtgttgctg cagtggcggt gacggccgcc gcggtactcc acttccgtga tccccacagt       120
     gcgggtagtt acggcgtttg tccgatgtac gcgttgacgg gattgtggtg cccggcgtgt       180
     ggtggcctcc gtgcggtcaa tgacctgact aatctggatg ttggcgccgc agtgtccagc       240
     aatgtcttga tcgtgccgtt tgtcgcggtg ttggtgatcg cgtggatcgg ttggacagtg       300
     cgccgttgga aaggcacgcg ggatcgcatg atcgtgcttc ggccgactgt gacgatcgtg       360
     gtgctcggag ttctcgttgc atttacggtt gttcgaaaca ccccgtgggg gagctggctc       420
     gcgccggcgt ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page