(data stored in ACNUC1104 zone)

EMBL: AP008957.PE521

AP008957.PE521       Location/Qualifiers
FT   CDS_pept        complement(581110..581976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05210"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31229"
FT                   /db_xref="GOA:C0ZNH7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNH7"
FT                   /protein_id="BAH31229.1"
FT                   /translation="MNPHETPLLAVEDLVVEYPVPDGVFRAVDAVSFSVEKGKTLAIVG
FT                   ESGCGKSTIARSIVRLLTPTSGRILVDGNDIAQMSEKSLRPFRSRVQMVFQDPYGSLDP
FT                   HLTAEDIIGEPLRLKGVRSKSERAKAAAELVDRVGLPSSALHRRPAEFSGGQRQRIGIA
FT                   RALASGPEILVCDEATSALDVSVQAQVLALLREIQADTGLTYVFISHNLGVVREISETV
FT                   VVMSKGTIVESGSTDTVLASPHEPYTRALRGAALDPTTMVGIKPRHVVAALSKNLLAKQ
FT                   TESRGVA"
     atgaaccccc acgaaacgcc acttctcgcc gtcgaagatc tcgttgtcga gtatccggtt        60
     cccgacggag ttttccgagc cgtggatgct gtgagcttct cggtggaaaa gggcaagacc       120
     ctggccatcg tcggcgaatc cggatgtggc aagtcgacaa tcgctcgatc tatcgtccga       180
     ctcctcacac cgaccagtgg acgcattctc gtcgacggca atgacatcgc gcagatgtcg       240
     gagaagtcac tgcgcccctt ccgctctcgc gttcaaatgg tgttccaaga tccgtacgga       300
     tcgctggacc cccatctgac tgccgaggac atcatcggag aaccactgcg cctcaaaggt       360
     gttcggagca agtctgaacg cgccaaggca gcagcagaac tcgtcgatcg cgttggcctg       420
     cccagctcgg cactacaccg gcgtccggcg gagttctccg gtggccaacg tcagcgcatc       480
     ggaattgccc gtgcacttgc cagcggaccc gagatcctgg tctgcgacga agcaaccagt       540
     gctctcgacg tttcggtgca agcgcaggta ctcgcgctcc tacgtgaaat tcaggccgac       600
     accggtctga cgtacgtttt catctcacac aacttgggcg tcgtccgaga aatcagcgag       660
     accgtagtcg tgatgtcgaa aggaaccatc gtcgaatccg gttccacaga cacagttctc       720
     gccagtccgc acgagccgta cacccgcgca ctacgtggcg ctgctctcga tcccaccacc       780
     atggtcggca tcaaaccacg ccacgtggtg gcagccctgt ccaagaactt gctagccaag       840
     cagaccgaat cacgaggagt tgcctga                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page