(data stored in ACNUC1104 zone)

EMBL: AP008957.PE525

AP008957.PE525       Location/Qualifiers
FT   CDS_pept        complement(584766..586328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05250"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31233"
FT                   /db_xref="GOA:C0ZNI1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNI1"
FT                   /protein_id="BAH31233.1"
FT                   /translation="MRTPQLSRRSFLQFTGLIGGATLLGTTAACAGPTGKPTQDTLVLG
FT                   LNRSLVSLDNKLNQFDAAVTAQRGVRQGLTRIGDNLTPQLVLADRFESTGPTEWTVRLR
FT                   EGIRYSDGTPVLIDDVTTAMQMYQQVSGSFVAPQFPEWPTVVPIDDRTFILRTNSPVPV
FT                   LDSLMSNILITPAAANEPNELQSGIGSGPFVVSESNRGTGDYTLVANDNYWGPAPGVRR
FT                   VQVRFIPEEAGRVVALRSGEVDVIDSISPDSAEQLADLPGVQVDTVPSTRINQLFFNFR
FT                   KPADHPLSNPRVREALTYAIDGESLARDVLIGSAVPATGPAPSTLDGAVKTGTYQYDPR
FT                   KARQMLEAEGADDLELTFIWETGEFTNDVSVMESVLEMMKAVGVRVKLQQFEPGGDISS
FT                   WRQGKTGDWDVLGNGYGNQTGLALTTLQGMYAGTAEKEATRDTYHGYVFPEITAKIQAA
FT                   SSEPDPTKRAALLDAAQQDIWNTWPCLWSFVPNALLAKRTRVQNVSLTPINSYDLGAVR
FT                   LEA"
     ttgcgaacac cacagctctc ccggcgatcc tttctgcagt tcaccgggct gatcggtggc        60
     gcaacgcttc tgggcacgac tgccgcgtgc gccggcccta ccgggaagcc gacccaggac       120
     accctggtgc tcgggctcaa ccgttcgctc gtcagcctcg acaacaaact caatcaattc       180
     gacgcagcag tcacggctca acgtggcgtc agacaaggtc tcacccggat cggcgacaat       240
     ctgacaccgc aactcgttct cgctgacagg ttcgaatcga ccggcccgac cgagtggacg       300
     gttcgactcc gcgagggcat ccgttactcc gacggcacac ctgtgctgat cgacgacgtc       360
     acgacggcaa tgcagatgta ccagcaggtc agcggatcgt ttgtcgcacc gcagttcccc       420
     gagtggccga cggtcgtccc catcgacgat cgcaccttca tccttcggac gaattccccg       480
     gtgccggttc tggactcgct catgtccaac atcttgatca ccccggccgc tgccaacgaa       540
     cccaacgaac tgcagagcgg aatcgggtct ggaccgttcg tcgtcagcga atcgaaccgg       600
     ggcaccggcg attacacact tgtcgccaat gacaactact ggggcccggc ccctggcgtt       660
     cgtcgtgttc aggtccgctt cattcccgaa gaggccggcc gcgtcgtcgc acttcggagc       720
     ggcgaggtcg acgtcatcga ctcgatcagt cccgattccg ccgaacaact cgccgacctg       780
     cctggtgtcc aggtggacac agtgccgagc acacgcatca accaactgtt cttcaacttc       840
     cgcaagcccg ccgatcaccc actgtccaat ccgcgtgtcc gagaagctct cacgtatgcc       900
     atcgacggtg agtcactcgc tcgggacgtg ctgatcggat ccgcagtccc ggccaccggc       960
     cccgcaccgt cgaccttgga cggagccgtg aaaaccggta cttaccaata tgatccacgg      1020
     aaagcgcggc agatgctcga ggccgaaggc gccgacgacc tcgaactcac cttcatctgg      1080
     gaaaccggag agttcaccaa cgacgtctcg gtgatggaat cggtactcga aatgatgaag      1140
     gccgtgggag tacgcgtcaa actccagcag ttcgaaccgg gcggtgacat ctcgtcctgg      1200
     cgccagggca agaccggcga ctgggatgtg ctgggcaacg gctacggcaa ccagaccgga      1260
     cttgcactga ccacgttgca ggggatgtac gccggcacag cggagaagga agcaactcgc      1320
     gacacctatc acgggtacgt cttccccgaa atcaccgcga agatccaagc cgcatccagt      1380
     gaaccagacc ctaccaagcg cgccgctcta ctcgacgccg cacaacaaga catctggaac      1440
     acctggcctt gcctgtggag cttcgtaccc aacgcactcc ttgcgaaacg cactcgtgta      1500
     caaaatgttt cactgacccc gatcaactcc tacgacctcg gcgccgtccg attggaggcc      1560
     tga                                                                    1563
//

If you have problems or comments...

PBIL Back to PBIL home page