(data stored in ACNUC1104 zone)

EMBL: AP008957.PE529

AP008957.PE529       Location/Qualifiers
FT   CDS_pept        complement(595899..596690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="istB"
FT                   /locus_tag="RER_05290"
FT                   /product="transposition helper protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31237"
FT                   /db_xref="GOA:Q3L9G1"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q3L9G1"
FT                   /protein_id="BAH31237.1"
FT                   /translation="MSTPLRTVTSANGDPLAEAIDLTKRLKLPHIRRSLSDIIPTAKAQ
FT                   RWDPAEVVRVLLAEEAAGRDRANLHTRRKRAGFPTGKTFGDWDETKSSIPRATQDALRT
FT                   LEWVGRRECFCVCGPSGTGKSHFTEALGQAAVEAGLAVSWFTIEDLGALVRRHRADDSI
FT                   ARALTRIIRSDLIIVDDIGLLPVSEDAAEGLYRLVDAAYERRAIAVSSNLHPSGFDEIM
FT                   PKTLATATVDRLLHHAHVVVTDGDSFRLTEATTGKGVKPFS"
     atgagcaccc ctttgcgcac tgttaccagc gctaacggcg acccgttggc cgaggcgatc        60
     gacctgacta aacgcctgaa actgccccat atccgcaggt ccttgagcga tatcatcccg       120
     accgcgaaag cccaacgctg ggaccccgcc gaagtcgtgc gggttctcct cgctgaggaa       180
     gccgccggcc gggaccgggc gaacctgcac actcgccgca aacgcgcggg tttccctacc       240
     ggcaagacct tcggcgactg ggacgaaacg aaatcgtcga ttccccgcgc cacccaggac       300
     gcgctccgca ccctggagtg ggttgggcgg cgtgaatgtt tctgcgtctg cgggccttcg       360
     ggaactggca agtctcactt caccgaggca ctcgggcagg ccgcagtcga agctgggctg       420
     gcggtgtctt ggttcaccat cgaagacctc ggtgccctgg tccgccggca ccgtgccgac       480
     gactccatcg cccgagccct gacgaggatc atccgctccg acctgatcat cgtcgacgac       540
     atcggtctgc tcccggtctc tgaagacgca gccgaaggac tctatcgcct cgtcgacgct       600
     gcttacgaac gccgagcgat tgccgtctcg agcaacctgc acccctccgg cttcgacgag       660
     atcatgccca aaacattggc caccgccacc gttgaccggc tcctgcacca tgcgcacgtc       720
     gtcgtcaccg acggcgactc cttccgcctc accgaagcca ccaccggcaa gggggtgaag       780
     cccttcagct aa                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page