(data stored in ACNUC1104 zone)

EMBL: AP008957.PE53

AP008957.PE53        Location/Qualifiers
FT   CDS_pept        68663..69559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30761"
FT                   /db_xref="GOA:C0ZLJ3"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLJ3"
FT                   /protein_id="BAH30761.1"
FT                   /translation="MRARRLVAVLSALAAAVVVPVVSSPVASADPCPGLYVVAIPGTWE
FT                   PSGTSPGAGMLAPVTNGLPGSVRTDYVTYSATAFPWESNVYAKSKQQAVDNARGMIAAM
FT                   AASCGDTRFAIVGYSQGADAAGDLAAEIGTGIGVVPPTRVEGVGLLSDPRRSESDVLIG
FT                   PAVGGNGASGARIGGFGWLSGKTVTLCAVGDLYCSTPKDDFVMRLAGFMAQVSDPTPAN
FT                   ALSLRDEAAVIVNDLVTAGGLPALMAQLDPGANSRRVDQLVAFYGSQVHTDYTRYVVDG
FT                   AGNSATSWLHNWLAGKA"
     atgcgtgcga ggcgtctcgt tgcggtgttg tcggcactag ctgcggcagt ggtggtaccg        60
     gttgtcagtt ctcccgtggc gtcggctgat ccctgccccg gtctgtacgt cgtggccatt       120
     ccgggaacct gggagccttc gggtacttct cccggtgccg gcatgcttgc cccggtcacc       180
     aacggccttc ccggttccgt acgcacggat tacgtcacgt actcggcaac ggccttcccg       240
     tgggagtcca acgtctacgc caagtcgaag cagcaggcag tcgacaacgc ccgcggcatg       300
     atcgccgcga tggccgcctc gtgcggtgac actcgcttcg cgatcgtcgg atacagccag       360
     ggcgccgacg cggcaggcga tctcgcagcc gagatcggaa ccggcatcgg cgttgtcccc       420
     ccgactcgcg tcgagggtgt cggcctcctg tccgatcccc gccgctccga gtcagacgtc       480
     ctgatcggac ccgctgtcgg aggcaacgga gccagcggcg ctcgcatcgg tggattcggt       540
     tggctgtcag gcaaaacggt gacgctgtgc gccgtcggtg atctgtactg ctcgacgccc       600
     aaggacgatt tcgtgatgcg tctggccggg ttcatggctc aggtttccga ccccactccg       660
     gcaaacgctc tctcgctgcg cgacgaggcc gccgtgatcg tcaacgatct ggtcactgca       720
     ggcggactcc ccgcactgat ggctcagctc gatccaggcg cgaactcgcg gcgcgtcgat       780
     caactggtcg ccttctacgg ctcgcaggtt cacaccgact acacgcgtta cgttgttgac       840
     ggcgcaggca attcggccac atcctggctg cacaactggt tggccggcaa agcctga          897
//

If you have problems or comments...

PBIL Back to PBIL home page