(data stored in ACNUC1104 zone)

EMBL: AP008957.PE534

AP008957.PE534       Location/Qualifiers
FT   CDS_pept        602457..603149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31242"
FT                   /db_xref="GOA:C0ZNJ0"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042001"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNJ0"
FT                   /protein_id="BAH31242.1"
FT                   /translation="MYESDPNPSNPYDDSNRDQPANIGKGRRVAFILALVAVLVAGASM
FT                   AFVGLRSSDDDAAIPPSPGVVMSHSANPAAPSDELMAPNTLSLDPVGVQAPIVDATVPE
FT                   GVLTPPENVKNVGIWLDGASLNSVTGTTLIAGHVNLTGQGNGALFDLGTIEPGEVIRTS
FT                   DATGKSTSWKVTAVTTRPKADGVEESVLAGPEGPRKLAVVTCGGELQFEDGVGNYADNV
FT                   YLYADLMV"
     atgtacgagt cggatcccaa tccatccaat ccatacgacg attccaaccg cgatcagccc        60
     gcgaacatcg gcaaggggcg tcgtgtcgcg ttcatcctgg ccctcgtcgc ggtgcttgtc       120
     gccggtgctt ccatggcttt cgtcggcctg cgatcctccg atgacgatgc tgcgattccg       180
     ccgagtccgg gagttgtcat gtcgcactct gcgaatccgg cggcgccttc ggatgagttg       240
     atggctccca ataccctttc gctcgatccg gtcggtgttc aggcgccgat cgtggacgcc       300
     accgtgccgg aaggagttct cactccgccg gagaacgtca agaacgtcgg aatctggctc       360
     gacggtgcct cgctcaactc ggtcaccggc acgactttga ttgccgggca tgtcaatttg       420
     accggccagg gtaacggtgc gctgttcgac ctgggcacga tcgaaccggg tgaagtgatc       480
     cgtacatccg acgcgacggg caagagcacg tcgtggaagg tgactgcggt gacgacgcgc       540
     ccgaaggccg atggcgtgga ggaaagcgtg ctggccggcc cggagggccc tcgcaagttg       600
     gcagtcgtaa cctgcggcgg cgaactgcaa ttcgaggacg gtgtgggtaa ctacgccgac       660
     aacgtctacc tgtacgcgga tctgatggtc tga                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page