(data stored in ACNUC1104 zone)

EMBL: AP008957.PE536

AP008957.PE536       Location/Qualifiers
FT   CDS_pept        complement(604039..605160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05360"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31244"
FT                   /db_xref="GOA:C0ZNJ2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNJ2"
FT                   /protein_id="BAH31244.1"
FT                   /translation="MTSQMKSMRTLTREWLALPDQYDRFTRYLRDNGLTTATRLLLGII
FT                   VIGLGVCALLNRFSPAGPTSTIALFFNTVVVISCFMVGVSWWVFGPTKRRSFGFVVFCD
FT                   IAVTISVLGDSSQLARLLTCVIYALIGIYIAYFHNPKLQIAHLTFSVVMIVVAAQPILF
FT                   GPERDPALGVSKVLVVVTALVVCAFISQIVLTMLSMDASSSDLDPLTGLLNRRGLDRHV
FT                   EKVLAEFQRQESAALLVIAIDIDRFKTINDVHGHDVGDRIILRVSQRLSAWAHADAVVA
FT                   RVGGDEFILAQRLSVPAIGPMLDSIGPAMHSNTDEIPSTSSIGIAVRTHKFVAGEERAT
FT                   AFTDMQKVADSAMYESKRLGGGRVHTIVTTASR"
     atgacgtcgc agatgaagtc catgaggacc ctgacccgcg agtggctggc cctccccgat        60
     caatacgacc gattcactcg ctatctccgc gacaacggcc tcacgaccgc cacccggcta       120
     ttacttggca tcattgtcat cggactgggc gtgtgcgcac tactcaacag attcagtccg       180
     gctggtccga caagcacgat tgcgctgttc ttcaacactg ttgtcgtgat ctcgtgcttc       240
     atggtcggag tctcatggtg ggtcttcggc ccgacaaagc gccgctcgtt cggtttcgta       300
     gtcttctgcg acatcgcagt cacgatttcc gtacttggag attcctcgca gcttgcgcga       360
     ttacttacct gtgtcatcta cgcgctgatc ggtatctaca tcgcctattt tcacaatccg       420
     aagttgcaga tcgcacacct gaccttctcg gttgtgatga tcgtggtggc tgcgcagccg       480
     atcctcttcg ggccggagcg agatcctgcg ctcggtgttt cgaaagtgct ggttgtcgtc       540
     accgcactcg tggtctgtgc gttcatctcg cagatcgtgc tgacgatgct cagcatggac       600
     gcgtccagct ccgacctcga tcccctcacc gggctcctga accgtcgtgg cctcgaccgc       660
     cacgtcgaga aggtactcgc ggagttccag cgtcaggaat cggcggcact actcgtgatc       720
     gcgatcgaca tcgaccggtt caagacgatc aatgacgtac acggtcacga cgtgggcgac       780
     cgcataattc tccgggtttc acagcggttg tccgcctggg cacatgccga tgctgttgtc       840
     gcacgggtcg gcggcgacga attcatcctc gctcaaagac tttccgtgcc ggccatcggc       900
     ccgatgctcg actcgatcgg accggcaatg cactcgaata ccgacgagat accgtcgaca       960
     tcgagcatcg gaatcgccgt gcgtacccac aaattcgtcg ccggagaaga gcgtgcaaca      1020
     gcgttcaccg acatgcagaa agtcgccgat tcggcgatgt acgaaagcaa gagactcggc      1080
     ggcggacgtg ttcacacgat cgtcaccacc gcgagcaggt ag                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page