(data stored in ACNUC1104 zone)

EMBL: AP008957.PE538

AP008957.PE538       Location/Qualifiers
FT   CDS_pept        605980..607254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05380"
FT                   /product="putative drug resistance efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31246"
FT                   /db_xref="GOA:C0ZNJ4"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNJ4"
FT                   /protein_id="BAH31246.1"
FT                   /translation="MSTQTIDAGTAAERRPGSERGTAGKWLWLTVAASMFAAAWGGNEF
FT                   TPLLVMYRLDHGYSPVMVDFFLFAYVVGIVPALLLGGPLSDRLGRRPIMLPAPIIAIAG
FT                   STLLAFGADSAAALILGRILCGIALGIGMAVGGSWVKELSTQPWDSTASEGAGARRAAM
FT                   SLTAGFALGAGAAGILAQWAPLPSVLAYVLHIAITVLAAMALWRAPETRPAQAKSDRRR
FT                   LIDDLKIPSAGHRRFLYVVVPLAPWVFGAASVAYAVIPALMTGHSGDAPVAFSALLCMV
FT                   ALTCGFAIQSLGRKIDTDRSARGAVVALVFLVVGMAGAALVASTLTVAIAIVAAAILGC
FT                   GYGMALVSGLLEIQRIAGPDDLAGLTAVFYSITYIGFAVPALLAMLSESIPALSYTVTL
FT                   LFGSAAAAACLILILFKSRSHLPSA"
     atgagcaccc aaacgataga cgctgggacc gcagccgaac gtcgtccagg cagtgaacgt        60
     ggcaccgccg gaaaatggct gtggctgacc gttgccgcca gcatgttcgc cgcggcctgg       120
     ggcggcaacg aattcacgcc actgctggtg atgtaccgac tcgatcacgg ctattcgccg       180
     gtgatggtcg acttcttcct cttcgcctac gtcgtcggaa ttgtgccggc cctgctgctc       240
     ggcggcccgc tgtccgatcg attgggtcga cgcccgatca tgctccccgc gccgataatc       300
     gcgatcgccg gttcgacgct gctcgctttc ggggccgact ccgctgccgc tctcattctg       360
     ggaagaatcc tctgcggcat cgccttgggg atcggtatgg ccgtcggcgg ctcctgggtc       420
     aaggagttgt ccacgcaacc ttgggattcg acggcgtcgg aaggcgcggg tgccaggcga       480
     gcagcgatga gtctgactgc cggcttcgcc ttgggggcgg gtgccgcggg aatcttggcg       540
     cagtgggcgc ccctgccgag tgtgctggcg tacgtcctgc acatcgcgat caccgtcctc       600
     gcggccatgg cgctgtggcg tgctcccgaa acacgaccgg cacaggcgaa atccgaccga       660
     cgcaggttga tcgacgacct caagatcccc tcggcaggtc atcgtagatt cctctacgtc       720
     gttgttccgt tggcgccgtg ggtgttcggt gctgccagtg tcgcgtatgc agttattccg       780
     gcgctcatga ccgggcacag tggcgatgcg cccgtggcct tttcagctct gctgtgcatg       840
     gtcgcgctga catgcggctt cgcgattcag tcgttggggc gcaagatcga taccgaccgc       900
     agcgcgcgcg gcgccgttgt ggctctggtg tttctggtgg ttggtatggc cggcgctgct       960
     ctggttgcgt cgacgctgac cgtggcgatc gcgatcgtgg ctgcagcgat cctcggttgc      1020
     gggtacggca tggcattggt ttccgggttg ctggagatcc agcgaatcgc ggggccggac      1080
     gatctggcag gactgaccgc ggtgttctac tcgatcacct acatcggttt tgctgtgcct      1140
     gcgttgctgg cgatgctgtc ggaaagcatt ccggcgctga gctacacggt gactcttctg      1200
     ttcggatcag ccgccgccgc tgcctgcttg attctgattc tcttcaagtc gcgttcacat      1260
     cttccgagcg cgtga                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page