(data stored in ACNUC1104 zone)

EMBL: AP008957.PE539

AP008957.PE539       Location/Qualifiers
FT   CDS_pept        complement(607304..608875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31247"
FT                   /db_xref="GOA:C0ZNJ5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="InterPro:IPR031905"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNJ5"
FT                   /protein_id="BAH31247.1"
FT                   /translation="MLPIIIIAVVVAVIIFIVLPAIYVKNYVKVPPNEVAVFTGRGKPK
FT                   VVRGGARFKIPGIERVDIMSLEPFNVSINLKNALSNDGVPVNVEAVGLVRIGSADEAVQ
FT                   TAVQRFLTSDLDELQQQINEILAGSLRGITATMTVEDLNSNRDSLARSVVEEAGGDLAR
FT                   IGMEVDVIKIAGISDFNGYLESLGQRRIAEVKRDAAIGTAEAERDSQIQSAKARQAGSV
FT                   AQAEADTAIASANQKRDVELARLRAQTEAENAEADQAGPLAQATAEKAVGIAREQAEAA
FT                   RVEARTEVERRRAQQSEAALQADVIAPAEAERQASIARAEGERQAAILRAQAQAESARQ
FT                   AGGAQADARKLVADAVRSEQQADADGLRARLEAEADGRKVAADAVRAEQQAEADGLRAK
FT                   LEAEAAGKRQIAEALNSYTPQAAQLLTLPDVLAALVDATAAAAKPVGDIDRISIVGGSD
FT                   GAQGSIGSILGISPQVIAGVIETLESSGVDITGLLNGLNKTASVPVGSVHNSVHNSENG
FT                   SATVDA"
     atgctgccaa tcatcatcat tgcggttgta gtcgcagtaa tcatcttcat tgttctcccc        60
     gcgatctacg tgaagaacta cgtcaaggtc ccgccgaacg aagtggcggt cttcaccgga       120
     cgaggcaagc cgaaggtcgt ccgcggcggt gcccggttca agattcccgg catcgaacgc       180
     gtcgacatca tgtcgctcga gccgttcaac gtcagcatca atctcaagaa tgcgctctcc       240
     aacgacggtg ttccggtcaa cgtcgaggca gtcggcctgg tacgaatcgg ttccgccgac       300
     gaagcggttc agacagcggt gcaacgattc ctgacttccg acctggacga actccagcag       360
     cagatcaatg aaatcctcgc gggcagtctg cgcggaatca ccgcgaccat gacggtcgag       420
     gatctgaact ccaaccgcga ctccctcgct cgcagcgtgg tcgaggaggc aggcggcgac       480
     ctcgcccgca tcggcatgga agtcgatgtc atcaagatcg cgggaatctc cgacttcaac       540
     ggctatctcg aatcgctcgg tcagcgccgc atcgccgagg tcaaacgtga tgccgcgatc       600
     ggaactgctg aagcagaacg tgattcgcag atccaatcgg caaaggcgcg acaggcaggt       660
     tccgtcgcgc aggccgaagc cgacaccgcg atcgcgagtg caaatcagaa acgcgacgtc       720
     gaactcgctc gcctgcgagc acagaccgaa gccgagaacg ccgaggccga ccaggccggg       780
     cccctcgcgc aggcaacagc cgagaaggcc gtcggcatcg cacgtgagca ggccgaggcg       840
     gcccgcgtcg aagctcgcac cgaggtcgag cgtcgtcgcg cccagcaatc ggaagcggca       900
     ttgcaggcag atgtcattgc accggccgag gccgaacgcc aagcctcgat cgcacgcgca       960
     gagggtgagc gacaggccgc gatcctccgc gcccaggcac aggccgagtc agcaaggcag      1020
     gccggcggcg ctcaggccga tgcacgaaag ctcgtcgccg acgctgttcg ctctgaacaa      1080
     caggctgatg ccgacggcct tcgagcacgt ctggaagccg aagccgacgg ccgcaaggtg      1140
     gcggccgatg cggttcgtgc cgagcaacaa gccgaggcgg atggtttgcg tgccaagctc      1200
     gaagccgagg ctgccggtaa gcgtcagatc gccgaggcgc tcaattccta caccccgcag      1260
     gccgcgcagt tgctcactct gcctgatgtt ctggcagcat tggtcgacgc caccgcagcg      1320
     gcggcgaagc cggtcggcga catcgaccgc atctccatcg tcggcggcag tgatggggcc      1380
     cagggttcga tcggctcgat cctgggcatc agcccccagg tgatcgccgg cgtcatcgaa      1440
     actctcgaaa gctcaggcgt cgatatcacc ggattgctca acggcctgaa caagaccgca      1500
     tcggttccgg ttggttcggt ccacaactcg gtccacaatt cggaaaacgg ttccgcaact      1560
     gtagacgcgt ga                                                          1572
//

If you have problems or comments...

PBIL Back to PBIL home page