(data stored in ACNUC1104 zone)

EMBL: AP008957.PE543

AP008957.PE543       Location/Qualifiers
FT   CDS_pept        complement(611684..615601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05430"
FT                   /product="putative non-ribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31251"
FT                   /db_xref="GOA:C0ZNJ9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR012728"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNJ9"
FT                   /protein_id="BAH31251.1"
FT                   /translation="MSRTGPTGLPLQSQSETEQSFGIPSVFLRSAHAPAPRTLIDIVRA
FT                   SAEANPEAPAIDDGDTTLSYSELLDEIALGARWLGDAGVGAGDRVGIRMPSGSRSLYVA
FT                   ILSILAAGAAYVPVDADDPEERAELVFGEAQVAAIITGDGIQPGTAPKRLEHPPVREPE
FT                   PEDDAWIIFTSGSTGTPKGVAVTHLNAAAFVDAEARMFLQDEPIGPGDRVLAGLSVAFD
FT                   ASCEEMWLAWRHGACLVPAPRSLVRSGMDLGPWLVSRDVSIVSTVPTLASLWPAEALEA
FT                   VRLLIFGGEACPPELAERLAVDGREVWNTYGPTEATVVACGALMDGKSPVSIGLPLDGW
FT                   DLAVVDAQSNPVAVGEVGELVIGGVGLARYLDPAKDAEKYASMPSLGWERAYRSGDLVR
FT                   LETTGLMFQGRADDQVKLGGRRIELGEVDNALQNLPGVSGAAAAVKKTAAGNQLLVGYI
FT                   ASTDPDFDLKAAHALLSEQLPAALVPRLALMDELPTRTSGKVDRNALPWPLPGAGEDAG
FT                   AALGLDGTAAWVAGLWGSILGAQITGLDDDFFEVGGGSLSAAQLVTALRERFPEVTVAQ
FT                   LYDHPRLGSLAEYLDELAPTETVEPRIVAPTPLKTQLAQIAVTVPLTTLTGLQWVTWLA
FT                   IANNVLGWFVDVSWAPTVSWWWILLAFIVFITPIGRMTIAVVGARLLLRKLEPGTYPRG
FT                   GSEHLRLWIALRLTEASGAANLSGAPWMLYYARALGADIGSGVDLHTLPPITGMLELGD
FT                   GCSVEPEVDLSGHWIDGDVIHIGEIKIGDGASVGSRSTLLPGARIGRDAVVEPGSAVFG
FT                   RVKANQQWAGSPATKVGKANHPWPAEHPKRAPGWVPVYGVTSVFLAGMPIFALMAGIAL
FT                   IGWWIRDTDTLASAVLQSLIMLPVATIVSLLVFAVVTLVAVRLLSIGLTPGYHPVRSRI
FT                   GWQVWATERLLDSARTFLFPLYASLLTPGWLRLLGAKIGKNVEASTVLLLPKFTTVADG
FT                   AFLADDTMVASYGLGGGWMHIEQAKIGKRAFLGNSGMTAPGRRVPKNGLVAVLSATPSK
FT                   AKSGSSWLGSPPVRLRRAAGDTDAARTFNPPMRLKIARGVVETCRLIPVMVTFGIGLGV
FT                   LFALEALVGAVGFWFAALLSGVILLVAGAVAGAITIAAKWIVVGRIAKVEHPLWSSFVW
FT                   RNEVADAFVETVAAPWFARAATGTAVLNIFLRGLGAKIGKGVWCESYWLPEADLVTLGD
FT                   GATVERGCVVQTHLFHDRIMSMDTVTLGAGATLGPHCVALPAAGIGAGATVGPASLVMR
FT                   GDTVPPSTRWQGNPIAPWVAS"
     gtgagtagaa caggaccaac gggtttgcca ctccagtcgc agtcggagac ggaacaatct        60
     ttcgggattc cgtccgtatt cctacggtcg gcgcatgcac ctgcgccgcg cacgctcatc       120
     gacatcgtgc gggcctcagc cgaggccaac ccggaagcac ctgccatcga cgacggcgac       180
     accacactgt cgtactcgga gttgctcgac gagatcgcgc tcggtgcgcg ctggctcggt       240
     gatgccggcg tcggcgcagg tgaccgcgtc ggaatcagga tgccgtcagg ttcgcgttcg       300
     ctgtacgtgg cgatcctgtc gatcctcgcg gcgggcgccg cctacgttcc cgtcgacgcc       360
     gacgatccgg aagagcgcgc cgagttggtg ttcggcgagg cgcaggtagc ggcgatcatc       420
     accggcgacg gaatccagcc ggggacggcg ccgaagcggc tcgaacatcc accggttcgc       480
     gaacccgaac ccgaggacga cgcctggatc atcttcacct caggatccac cggcaccccc       540
     aagggcgtcg cggtcactca cctcaatgcc gcagccttcg tcgacgccga ggcgcgcatg       600
     ttcctccagg acgagcccat cgggcctggt gaccgcgtcc tcgcgggact ctccgtggca       660
     ttcgacgcgt cctgcgagga gatgtggctc gcgtggcgcc acggcgcctg cctcgtcccg       720
     gctcctcgtt cgctggttcg cagcggcatg gacctcggcc cgtggctggt ctcgcgtgac       780
     gtcagcatcg tctccactgt gccgacgctt gcgtctctgt ggccggccga ggccctcgaa       840
     gccgttcgac tcctgatctt cggcggcgaa gcctgcccac ccgaactggc agagcgcctg       900
     gccgtcgacg gccgcgaggt ctggaacact tacggcccca ccgaggcaac cgtcgtcgcc       960
     tgcggcgcac tgatggacgg caagagcccc gtcagcatcg gcctccccct cgacggctgg      1020
     gaccttgccg tcgtcgacgc ccagagcaat cccgtcgcgg tcggcgaggt gggcgagctg      1080
     gtgatcggcg gcgtcggcct cgcccgttac ctcgaccccg cgaaggacgc cgagaagtac      1140
     gcgtcgatgc cctcgctcgg gtgggaacgc gcctaccgaa gcggcgacct ggtccggctc      1200
     gagaccaccg gcctgatgtt ccagggccgc gcggacgatc aggtcaagct cggcggcagg      1260
     cgcatcgaac tcggtgaggt cgacaacgcc ttgcagaacc tgccgggcgt gagcggcgct      1320
     gccgcagccg tgaagaagac tgcagccggc aatcaactcc tcgtcgggta catcgccagc      1380
     acggatcccg acttcgatct caaggccgct catgcactgc tcagcgagca gctaccagca      1440
     gccctcgtgc cgcgtctggc gttgatggac gaacttccga cgcgtacgtc aggcaaggtc      1500
     gaccgcaatg cgctgccgtg gccgttgccc ggcgccggtg aagatgccgg ggccgcgttg      1560
     ggcctcgacg gcaccgccgc ctgggttgcc ggtctgtggg gatcgatcct gggagcccag      1620
     atcaccggac tcgacgacga cttcttcgaa gtgggcggcg gatccctctc tgctgctcag      1680
     ttggtgaccg ccctgcgcga gcggttcccc gaagtgaccg tcgcacagct ctacgaccat      1740
     ccacggttgg gatcgctcgc cgaatatctc gacgaattgg cacccaccga aactgtggag      1800
     ccgcgcatcg tcgctccaac acccttgaaa actcagctgg cgcagatcgc cgtcaccgtt      1860
     ccactcacga cgctcaccgg actgcagtgg gtgacgtggc tggcgatcgc gaacaacgtc      1920
     ctcggctggt tcgtcgacgt cagctgggcg cccacggtct cgtggtggtg gatcctgttg      1980
     gcgttcatcg tgttcatcac gccgatcggc cgtatgacca tcgccgtcgt cggggcgcgc      2040
     ctgctcctac gcaagttgga accaggaacg tacccgcgag gtggtagtga gcacctgcgt      2100
     ctgtggatag cgctgcgact caccgaagcc agtggcgcag ccaacctttc gggcgcaccg      2160
     tggatgctct attacgcccg cgccctcggc gccgacatcg gcagcggcgt cgatctccac      2220
     acacttcctc ccatcaccgg catgctcgaa ctcggtgacg gctgctccgt cgaacccgaa      2280
     gtcgacctct cgggccactg gatcgacggc gacgtcattc acatcggtga gatcaagatc      2340
     ggcgacggcg cctccgtcgg ttcacgctcg acgcttctgc ccggcgcgcg tatcggtcgg      2400
     gacgccgtcg tcgaacccgg atctgcggtg ttcggccgag tgaaggcaaa ccagcagtgg      2460
     gccggctccc ccgccaccaa ggtcgggaaa gcgaatcatc cttggccggc cgaacatccg      2520
     aagcgcgcac ccggctgggt gccggtatac ggcgtcacct cggtcttcct ggccggtatg      2580
     ccgatcttcg ctctgatggc cggaatcgcc ttgatcggtt ggtggatccg cgacaccgac      2640
     acgctcgcga gtgcagtgct ccaatcgctg atcatgcttc ccgtcgcgac catcgtgagt      2700
     ttgctcgtct tcgcagtcgt cacactggtg gccgttcgtc ttctctcgat cgggctgacc      2760
     cccggctacc accctgtccg cagccgcatc ggctggcagg tgtgggcgac cgaacgcctg      2820
     ctcgactcgg ccagaacctt cctcttcccg ctctacgcga gcctgctgac gccgggatgg      2880
     ctccgcctcc tcggcgccaa gatcggcaag aacgtcgaag catccaccgt gctcctcctt      2940
     cccaagttca cgacggtcgc cgacggcgca ttcctcgccg acgacaccat ggttgcaagc      3000
     tacggcctcg gcggcggctg gatgcacatc gaacaggcga agatcggcaa gcgtgcgttc      3060
     ctcggcaact ccggtatgac cgcacccggt cgacgcgtcc ccaagaacgg tctcgtggcg      3120
     gttctgtcgg ccaccccgtc caaggccaag tccggatcat cgtggctggg tagtccaccg      3180
     gtacgtctga gaagggctgc cggggacacc gacgccgccc gcacgttcaa tccgccgatg      3240
     cgcctcaaga tcgcccgcgg agtggtcgaa acctgccgac tgatccccgt gatggtcacg      3300
     ttcggcatcg gtctcggtgt tctgtttgca ctcgaagcac tggtcggcgc cgtcggattc      3360
     tggttcgcgg ctctgttgag cggcgtaatt ctgctcgtcg ccggagcagt ggctggcgcc      3420
     atcaccatcg ccgccaagtg gatcgtcgtc ggacgcatcg ccaaggtcga gcatccgctg      3480
     tggagttcgt tcgtctggcg caacgaggta gccgatgcgt tcgtcgaaac cgtcgcggcg      3540
     ccgtggttcg ctcgcgcagc gactggtact gccgtactca acatcttctt gcgtgggctc      3600
     ggggccaaga tcggcaaggg cgtttggtgt gagtcgtact ggctacccga ggcagatctt      3660
     gtgactttgg gcgacggagc gacagtggaa cgggggtgcg tcgtgcaaac tcatctcttc      3720
     catgatcgga tcatgtccat ggacaccgtc accttgggag caggagcaac gctgggaccg      3780
     cattgtgtcg cgctacccgc agccgggatc ggcgcgggag cgacggtagg gcctgcatct      3840
     ctggtgatgc gaggtgacac cgttccgccc tccacccgct ggcagggcaa tccgattgca      3900
     ccgtgggtgg cgtcgtga                                                    3918
//

If you have problems or comments...

PBIL Back to PBIL home page