(data stored in ACNUC1104 zone)

EMBL: AP008957.PE546

AP008957.PE546       Location/Qualifiers
FT   CDS_pept        618426..618752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31254"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNK2"
FT                   /protein_id="BAH31254.1"
FT                   /translation="MVIMEIRDAVERLRADSGTSMIFGEPHQTSDGSTIITVSRLHRRW
FT                   RGDPIPVPVGVFSIHEGEPSWSPAVDHTRAALMGEFIGLAAAVIATLAVLRRPPWPDVT
FT                   IRKG"
     atggtgatca tggagattcg tgatgcggtg gagcgacttc gggcggattc cgggacctcg        60
     atgatcttcg gtgaaccgca tcagaccagc gacggatcga cgatcatcac ggtttcgcgt       120
     ctacaccggc ggtggcgggg cgacccgata ccggtgccag tgggagtgtt ctcgatccac       180
     gagggtgagc cgtcgtggtc accggccgtc gatcacacca gggcggcttt gatgggggag       240
     ttcatcgggt tggcggccgc ggtgatcgca accctggccg ttctacgtcg accgccctgg       300
     cctgatgtga cgattcggaa ggggtga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page