(data stored in ACNUC1104 zone)

EMBL: AP008957.PE556

AP008957.PE556       Location/Qualifiers
FT   CDS_pept        complement(629074..629937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05560"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31264"
FT                   /db_xref="GOA:C0ZNL2"
FT                   /db_xref="InterPro:IPR011965"
FT                   /db_xref="InterPro:IPR013225"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNL2"
FT                   /protein_id="BAH31264.1"
FT                   /translation="MDVDVPTRILIEGLLRTDGTVDGRTLYATADALGKTDQQVRLCIK
FT                   RLVTEGKFTQEGRGRQATLRATPKALREMEPDVEFVRLAYQQDRDTVTPWDGYWHLAGF
FT                   AIPESSRKARDALRTRVVYLGGALVQGGLYVSPHAWEPYIRDAAAELDVEQHLSSLTTR
FT                   DLKVGMLEDPVKIAAQLWPLDQIADGYERLLDVATARLHKLQNSPGTDAVTMTIELAAE
FT                   FTRAMEPDPLLPPELLPTNWIGTRARSITAQCWTLLAQVDGADELPSLFHLYADAIGDD
FT                   QDASVR"
     atggacgtcg atgtacccac gaggatcttg atcgagggac tactgcgcac ggacggaact        60
     gtcgacggac gcacccttta tgccaccgcc gacgccctcg gcaaaactga tcaacaggtt       120
     cggctgtgca tcaagcggtt ggtcaccgag gggaagttca ctcaggaagg tcgcgggcgg       180
     caggccacgc tacgagcaac gccgaaagcc ctgcgcgaga tggaacccga cgtcgaattc       240
     gttcggctgg cctatcaaca agaccgcgac actgtgacgc cgtgggacgg gtattggcac       300
     ctggccggat tcgcaattcc ggagtcgtca cggaaagcgc gagatgcgct gcgtaccagg       360
     gtcgtttacc tcggcggcgc gctcgtccag ggcggtctgt acgtctcgcc gcacgcctgg       420
     gaaccgtata ttcgcgatgc ggccgccgaa ctcgacgtcg aacagcacct gtcttctctt       480
     accactcgag atctgaaagt gggcatgctc gaagaccctg tgaagattgc cgcgcagttg       540
     tggccactgg accagatcgc tgacggatac gaacggctac tcgacgtagc gaccgcacgc       600
     ctgcacaaac tgcagaacag tccgggtacc gatgctgtca cgatgaccat cgaactcgcg       660
     gcggaattca cgcgagccat ggaaccggat ccgctattgc cgccggaact actgcccacc       720
     aactggatcg gcacgagggc tcggtcgatc actgcgcaat gctggacgct tctggcacag       780
     gtggacggtg ccgacgaatt accgtcgctg ttccacctgt acgcagatgc aatcggtgac       840
     gatcaggacg caagcgtgcg ctga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page