(data stored in ACNUC1104 zone)

EMBL: AP008957.PE560

AP008957.PE560       Location/Qualifiers
FT   CDS_pept        complement(632736..633113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31268"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNL6"
FT                   /protein_id="BAH31268.1"
FT                   /translation="MKHCADHRLPEILRDTHHRLRRAGTVASETPVVAADLYWSIGALA
FT                   QCLTAMDEVISQLGINARKQLRAGKFDVQSGPFEGEPDAALLTAVLALARASSSCEPVQ
FT                   AAIGNAQIAVSDLVVARTTSA"
     atgaaacatt gcgcagacca cagactgccc gagatactcc gagacactca tcaccgattg        60
     cgccgcgccg gcaccgtggc atcggaaacg cctgtcgtcg ctgccgatct ctactggtcg       120
     atcggcgcac tcgcccagtg cctgaccgcg atggacgagg tcatttcaca acttggaatc       180
     aatgcccgaa agcagttgcg agctggaaag ttcgacgtcc agagcggacc gttcgaagga       240
     gagcccgacg ccgccttact caccgcagtt cttgcgctcg ccagagcatc gagtagttgc       300
     gaaccggttc aggcggcaat cggcaatgcc cagatcgcgg tgagtgatct cgtcgtcgcg       360
     aggactacca gcgcctga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page