(data stored in ACNUC1104 zone)

EMBL: AP008957.PE573

AP008957.PE573       Location/Qualifiers
FT   CDS_pept        complement(645218..646819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05730"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31281"
FT                   /db_xref="GOA:C0ZNM9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNM9"
FT                   /protein_id="BAH31281.1"
FT                   /translation="MKHRSYSTLAATAGLALVLSACSSGGTSSGSGGGEPLTDGTFRYA
FT                   LQGDPGALNPIMSGSAATAEISKLAYDSLVYQDPETSEFKPWLAEKWEETPTSASFTIR
FT                   EGVTCTDGSTLTAQTVANNINFVADPAKGSQQRGTTVPIGASATADLATRTITVTTPAP
FT                   TPFLLLTISRLPIMCDAGLEDPTASNNKSLGSGMFEVTEVSANDHYTFERRDGYSWGPD
FT                   DTTSDTPGVPKTVIAVMAPNVSTAANQLLSGELSASPIAGPDKDRIDAANFDSVQRPLP
FT                   AGQMYFNQIADNPTSDPAVRKALVQAVNLDDLAEVITGGQGTRATSLVSVEPRACVYDS
FT                   VAGNIPDFDLSAAKATLDAAGWIAGSDGKRSKDGKPLTLRLFYAAGEDARSAAAELTQS
FT                   AWSDLGATVEVTGADQTKVVDVMLSGKDNNQWDIAWIQINNSVPSGFVPFFSGPAPAAG
FT                   KNFSSINNPAYEAAVAKASGLTGEEACAEWADAESQITKTVSAVPFADTVLSFYFNKAG
FT                   LAFGKTFIGSALRLYQ"
     atgaaacacc gctcctattc gacgcttgcc gcgaccgcgg ggctcgcgct cgtattgtcg        60
     gcttgcagct cgggaggcac gtcctcgggc tccggcggcg gtgagcctct gactgacgga       120
     accttccggt acgcgttgca aggcgatccg ggtgcactca acccgatcat gtccggctct       180
     gcggcaaccg cggaaatttc gaagctggcg tacgactcct tggtctacca ggatcctgaa       240
     accagtgaat tcaaaccatg gttggccgag aagtgggaag aaacgccgac ctccgcgtcc       300
     ttcaccattc gtgaaggcgt gacctgtacc gacgggtcga cgctgactgc acagaccgtc       360
     gcgaacaaca tcaacttcgt agccgatcca gccaagggtt cacaacaacg cggcaccaca       420
     gttcccatcg gcgcttcggc cactgccgat ctcgccaccc gcaccatcac ggtaaccact       480
     ccggcgccga ccccgttcct cctcctcacc atcagtcgcc tcccgatcat gtgcgatgcc       540
     ggtctcgaag atccgaccgc ctcgaacaac aagtcgctgg gctccggcat gttcgaagtc       600
     accgaagtct cggccaatga ccactacacg ttcgagcgtc gtgacggtta cagctggggg       660
     cccgacgaca ccacctccga cacaccgggt gtccccaaga cagtcattgc tgtcatggca       720
     cccaatgtca gcaccgcagc aaaccagctt ctctcaggcg aactgagcgc atctccgatc       780
     gccggtccgg acaaggatcg catcgatgcc gccaatttcg actcggtcca gcgcccactt       840
     cccgccggtc agatgtactt caatcagatt gcggacaatc cgaccagtga tcccgccgtt       900
     cgaaaagctc tcgtccaggc tgtcaatctc gacgatctcg ctgaagtcat cactggcggc       960
     cagggcaccc gtgcaacaag tcttgtctcc gtcgagcccc gagcctgtgt gtacgactct      1020
     gtcgcaggca acattccgga cttcgacctc agcgcagcaa aggcaacact ggacgctgca      1080
     ggttggatcg ccggctccga cggcaaacga agcaaggacg gaaagccgct gaccctccgc      1140
     ctcttctacg ctgccggcga agatgcgcgc agcgcggcag ccgagctcac ccagtcggca      1200
     tggtccgacc tcggtgcgac cgtcgaggtg acaggagccg accagaccaa ggttgtcgac      1260
     gtcatgctca gtggcaagga caacaaccag tgggacatcg cgtggatcca gatcaacaat      1320
     tcggttccca gcgggttcgt cccgttcttc tccggtcctg ctccggcagc aggtaagaac      1380
     ttctcttcga tcaacaaccc cgcctacgaa gcagccgttg ccaaggcatc cggcttgacc      1440
     ggcgaagaag cgtgcgcgga gtgggcagac gccgagtcac agatcaccaa aacggtgtcc      1500
     gcagtcccgt ttgcagatac ggtcttgagc ttctacttca acaaggccgg actcgcattc      1560
     ggtaagacct tcatcggttc tgcgttgcgc ctctaccagt ag                         1602
//

If you have problems or comments...

PBIL Back to PBIL home page