(data stored in ACNUC1104 zone)

EMBL: AP008957.PE574

AP008957.PE574       Location/Qualifiers
FT   CDS_pept        complement(646983..647420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31282"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNN0"
FT                   /protein_id="BAH31282.1"
FT                   /translation="MFRLYCNSAGPYVLCCAHFPEFTGSNSDEEFSVQQSFDRAVEKIL
FT                   RDASFEPTTLTLVGEQQGYPVGDRLFDTTVPRTGTVSYAFQEAGPSWIVLGLDVSADEF
FT                   WSEIDDDADLHGLGPTSPLRSVPATVLTETGWPRRSDLDSP"
     gtgtttcgtc tctactgcaa ctcagcaggc ccatacgttt tgtgttgtgc gcatttcccc        60
     gagttcaccg gttcgaactc ggacgaagag ttcagcgtcc agcagagctt cgaccgcgca       120
     gtcgagaaga ttctgcgcga tgcatccttc gaaccgacta ccttgacttt ggtcggcgag       180
     cagcagggct atcccgtcgg agaccgactg ttcgatacga cagttccgcg taccggaacc       240
     gtctcatacg cgttccaaga agccggaccg tcgtggatcg ttctcggcct tgatgtttcg       300
     gcggacgaat tctggtccga aatcgacgac gacgcagacc tccacggtct cggccccacc       360
     tccccgttga ggtcagttcc agcaaccgtg ctcacggaga ccgggtggcc acgacgaagt       420
     gacctcgact ccccgtga                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page