(data stored in ACNUC1104 zone)

EMBL: AP008957.PE585

AP008957.PE585       Location/Qualifiers
FT   CDS_pept        complement(661193..661666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05850"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31293"
FT                   /db_xref="GOA:C0ZNP1"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNP1"
FT                   /protein_id="BAH31293.1"
FT                   /translation="MTSLLHPNASHVAETLISRGHHGVIVTQPEATHTAAEAAAAVGVE
FT                   VGAITKSLVFLLDDDPVLLLVSGAHQVNLKATGERLEGKLTRAPLEMAKSATGQPIGGV
FT                   APLGHPTNLPTYIDTALEQYPELWAAAGHPNTVFRTTYSELLRITAGLAVDMD"
     atgacgagcc tcctccaccc caacgcctcg cacgtcgccg aaacactgat ctcacggggt        60
     caccacggcg tcatcgtcac gcagcccgaa gccacgcaca ccgcggccga ggcagcggcg       120
     gccgtcgggg tggaggtagg cgcgatcacc aagtcgctcg tgttccttct cgacgacgat       180
     ccggtcctac tgctggtctc cggcgcacat caggtcaatc tgaaagccac cggcgaacgc       240
     ctcgaaggca agctcacgcg ggcgccgctg gaaatggcga agtcggcaac gggccagccg       300
     atcggtgggg tcgctccgct cgggcatccc accaacctgc ccacctacat cgataccgcc       360
     ctcgagcagt accccgaatt gtgggctgct gccgggcacc cgaacacggt ctttcgcacg       420
     acgtactccg aactccttcg aatcacggcc ggcctcgccg tcgacatgga ctga             474
//

If you have problems or comments...

PBIL Back to PBIL home page