(data stored in ACNUC1104 zone)

EMBL: AP008957.PE594

AP008957.PE594       Location/Qualifiers
FT   CDS_pept        complement(672085..673206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05940"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31302"
FT                   /db_xref="GOA:C0ZNQ0"
FT                   /db_xref="InterPro:IPR007427"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNQ0"
FT                   /protein_id="BAH31302.1"
FT                   /translation="MVLRIFGLSIAISIIAMIVAFIYGGPEALFLVIILSILEISLSFD
FT                   NAVINATVLRRMSDFWQKIFLTIGIVIAVFGMRLVFPLVIVWAASGLGPVAALDLALNP
FT                   PADDAAYFANGEPSYETILTDAHPQIAAFGGMFLLMLFLGFIFEEREITWLSWLEKPLA
FT                   RIGKLDQLSVVVAGIVLVLSGSFLAADDKVSTVMISGVLGMITYIAVNGLGELFNLPEE
FT                   GEEEETTKSGGPTEFAKATGKAGFFLFLYLEVLDASFSFDGVIGAFAITADPIIIALGL
FT                   GFVGAMFVRSITVFLVRKGTLSDYVYLEHGAHWAIGALAVILMVSIGVHINEIITGLVG
FT                   VFLIGAAFISSLIRNKRIANADPKLDENTPATV"
     gtggtactgc gaatattcgg tttatccatc gcgatctcca tcatcgcgat gatcgtcgcg        60
     ttcatctacg gcggacccga ggcactgttc ctcgtcatca tcctgtcgat tctggaaatc       120
     tcgctttcct tcgacaacgc cgtcatcaat gccaccgttc tgcgaagaat gagtgacttc       180
     tggcagaaga tcttccttac catcggcatt gtcatcgccg tcttcggtat gcgtctggtg       240
     ttcccgctcg tgatcgtctg ggctgcttcc gggctcggac ctgtagctgc gctcgacctc       300
     gcgctcaacc cgcctgcaga cgacgccgct tacttcgcca acggcgagcc gagctacgaa       360
     accatcctca ccgacgctca cccgcagatc gctgccttcg gtggcatgtt cttgctgatg       420
     ctcttcctcg gcttcatctt cgaagagcgt gagattacct ggctgtcctg gctggagaag       480
     cccctcgctc gcatcggcaa gctcgatcag ctctccgtcg tcgtagccgg catcgtcctg       540
     gttctcagtg gttctttcct cgccgctgac gacaaggtct ccaccgtcat gatctcgggc       600
     gttctgggca tgatcaccta catcgcggtc aacggattgg gtgaactgtt caacttgccg       660
     gaagaaggcg aagaagagga gaccaccaag tccggtggtc ccaccgaatt cgcgaaggca       720
     accggcaagg ccggcttctt cctgttcctc tacctcgagg tcctcgacgc gtccttctcc       780
     ttcgacggcg tcatcggcgc attcgccatc actgcagacc cgatcatcat cgccctcggc       840
     ctcggcttcg tcggcgcgat gttcgtccgt tccatcacgg tcttcctggt ccgcaagggc       900
     acgctctccg attacgtcta cctcgaacac ggtgcgcact gggccatcgg cgctctggcc       960
     gtcatcttga tggtgtccat cggcgttcac atcaacgaga tcatcaccgg cctggtcggt      1020
     gtcttcttga tcggcgctgc tttcatcagc agcctcattc gcaacaagcg aatcgcgaac      1080
     gcagatccga agttggacga gaacactccg gcaactgtct ga                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page