(data stored in ACNUC1104 zone)

EMBL: AP008957.PE6

AP008957.PE6         Location/Qualifiers
FT   CDS_pept        6946..7857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30714"
FT                   /db_xref="InterPro:IPR016516"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLE6"
FT                   /protein_id="BAH30714.1"
FT                   /translation="MSQKISTPASSFAEPDHILLQARNVEFDWSDLPMHWIPGDPFSTH
FT                   VLNVLHLLLPAGEEWFVETFKEALPLIEDEKLREDVVGFIGQEAMHSNAHSGVLVHLKE
FT                   NGLDPTPYTQQMEWAFSKLLGPRPMTGLRAENHLVERLAIIAAIEHITAFLGDWVLNAK
FT                   GLDKAGMHPTMLDLLRWHGAEEVEHRAVAYDVMRYFDKRETRRIRTQILVTPAIVWLWI
FT                   RGTRFLMRNDPELAAQAPSRRRPHLSDFIAAGKRGTVPTSFELVKRMSTYFSKSYHPSN
FT                   EGSTAQAVQYLASSPAAQAAAR"
     atgtcgcaga agatatcgac acccgcttcg tcgttcgccg agccggatca catcctgttg        60
     caggctcgca atgtcgagtt cgactggtcc gatctgccta tgcactggat tccgggcgat       120
     ccgttcagca cacacgttct caacgtgctt cacctcctgc tcccagccgg tgaggagtgg       180
     tttgtcgaga ccttcaagga agctcttcct ctgatcgagg acgagaaact ccgtgaagac       240
     gtcgtcggat tcatcggcca agaggcgatg cactccaacg cgcactcggg tgtcctcgtc       300
     catctcaagg aaaacggcct ggatccgacg ccgtacaccc agcagatgga gtgggcattc       360
     tcgaaactgc tcggaccgcg cccgatgaca ggtctgcgcg ccgagaatca cctggtggag       420
     cgtctggcta tcatcgcggc catcgaacac atcactgctt tcctcggcga ctgggtgctc       480
     aacgccaagg ggctcgacaa agccggcatg cacccgacca tgcttgatct tcttcgctgg       540
     cacggcgccg aagaagtcga acaccgcgcc gtcgcgtacg acgtgatgcg ctacttcgac       600
     aagcgtgaga ctcgccggat ccgtacccag atcctcgtca cgcccgcaat cgtgtggctg       660
     tggattcgtg gaacccggtt cttgatgcgc aacgatcccg agcttgccgc tcaggctccc       720
     agccgtcgaa ggccccacct gtccgatttc atcgcggccg gaaagcgtgg cacagttccc       780
     acgtcgttcg agctggtcaa gcggatgtcg acgtacttca gcaagtccta tcaccccagt       840
     aacgagggct cgaccgccca ggcggtgcag tacctggcgt cgtcacccgc agctcaggcg       900
     gctgcacggt ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page