(data stored in ACNUC1104 zone)

EMBL: AP008957.PE605

AP008957.PE605       Location/Qualifiers
FT   CDS_pept        complement(684472..684993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31313"
FT                   /db_xref="InterPro:IPR018020"
FT                   /db_xref="InterPro:IPR036778"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNR1"
FT                   /protein_id="BAH31313.1"
FT                   /translation="MLLHQSIGLERFNELPRQKAVHALFECCCSLTWAGWVSDGRPFAD
FT                   HAEILSRAEDAILNLSDVDVERALQCHPPVGVRRNSVPSHLEQCSIWVPDDAVMATIYR
FT                   AGEEYERNFGFRYLWCSHGHDADDLLENIGQRMSNERSVERKVCVDELAKITRTRIERM
FT                   LGPEDGYPEY"
     atgctgctac atcaatcgat cgggttggag cgcttcaacg aactaccgcg acagaaggcg        60
     gttcacgcat tgttcgagtg ctgctgctct ctgacgtggg ccgggtgggt cagcgacgga       120
     cgtccgttcg ccgatcacgc ggagatcctc tcgcgcgccg aggacgcgat tctcaacctc       180
     tcggacgtcg acgtcgagcg agcattgcaa tgccatccac cggtcggcgt ccgtaggaac       240
     agcgtgccgt cccacctcga gcaatgctcg atctgggttc cggacgacgc cgtcatggca       300
     accatctatc gcgccggcga ggagtacgag cggaacttcg gcttccggta tctgtggtgt       360
     tcgcacggcc acgacgccga cgacctgctc gagaacatcg gccagcgcat gtccaacgag       420
     cggtccgtcg agcgcaaggt ctgcgtcgac gagctcgcca agatcacgcg gacgaggatc       480
     gagcgcatgc tgggacccga ggacggttat cccgagtact ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page