(data stored in ACNUC1104 zone)

EMBL: AP008957.PE612

AP008957.PE612       Location/Qualifiers
FT   CDS_pept        complement(691193..693172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06120"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31320"
FT                   /db_xref="GOA:C0ZNR8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNR8"
FT                   /protein_id="BAH31320.1"
FT                   /translation="MVTAADNEVPADNTAPSVKQRTEAWLLADITEEPAGHLGPHRMAP
FT                   KKEKRHPWWKVMCLTGVDYFSTLGYQPGIAALAAGTLAPIATVVLILLTLFGALPVYRR
FT                   VARESPHGEGSIAMLEKLLPKWRGKIFVLVLLGFAATDFLITMTLSAADATAHLVENPF
FT                   APTFLSGHTVAVTLVLLALLAAVFLRGFTEAIGIAVGLVAVYLALNVVVISVGLWHIAT
FT                   APSLVTDWTRAMTTEHGNPAMMILIALIVFPKLALGLSGFETGVAVMPQIKGDPHDTEQ
FT                   NPRGRIKGARRLLTTAALIMSGFLLTSSLVTTILIPENEFQPGGAANGRALAFLAHDYL
FT                   GEIFGTAYDLSTILILWFAGASAMAGLLNLVPRYLPRYGMAPSWARAVRPLVLVFSVIA
FT                   ITVTIYFDAGVDAQSSAYATGVLVLISSATVAVALSARKHGQRKLFVGFSFVAVLFVYT
FT                   TIANIFERPDGVKVASFFIAAITVVSFLSRISRAFELRATSVEFDETALRFIAEAAEKG
FT                   YLAMVAHDVDRLDEDEYRKKESQQRAESNIPEAESIIFIEVNVTDSSEFSTDLLVHGRQ
FT                   RGEHRILWVDSPAVPNTIAAVLLRTRDITGVIPDVYFEWTEGNPIMYLLRFLFIGEGET
FT                   APVTREVLRRAEPDQSRRPHVHVG"
     gtggtgaccg cagccgacaa cgaggtcccg gccgacaaca cggctccgtc tgtgaaacaa        60
     cgcaccgagg cctggctgct cgcggacatc accgaggaac cagccggaca tctggggcca       120
     caccggatgg cgccgaagaa ggagaagcgc cacccgtggt ggaaggtgat gtgcctgact       180
     ggtgtcgatt acttctccac tctcggttac caacccggta tcgcggcact ggcggccggc       240
     acgttggctc ccatcgcgac agtcgtgttg attctgctga cgctgttcgg tgcgctcccg       300
     gtctaccggc gagtggctcg cgagagtccg cacggcgagg gctcgatcgc catgctcgag       360
     aagttgctgc ccaagtggcg cggcaagatc ttcgttctcg tgcttctcgg cttcgcggcc       420
     accgatttcc tcatcactat gacgctctcg gctgccgatg ccacggcgca cctcgtcgag       480
     aatccttttg ctccaacctt tctctccgga cacaccgtcg ccgtcaccct tgttctgctc       540
     gcgctcctcg ctgcggtatt cctccgcgga ttcaccgaag cgatcggtat cgcggtcgga       600
     ttggtcgccg tctacctcgc cttgaacgtg gtggtcatct ccgtaggttt gtggcacatc       660
     gcgaccgcgc cgtcgttggt caccgactgg acgcgcgcca tgaccaccga gcacggaaac       720
     ccggcgatga tgatcctgat cgcgctgatc gtcttcccga agttggctct tggtctgtcc       780
     ggcttcgaaa ccggcgtcgc ggtcatgccg cagatcaagg gcgatccgca cgacacggaa       840
     cagaatccac gtggtcgaat caaaggcgca cggcgcctgc tcaccactgc ggcgctgatc       900
     atgagcggat tcctgctgac gtcgagcctg gtcaccacca tcctgatccc agaaaacgag       960
     ttccaacccg gaggcgctgc caacggtcgc gcgcttgcct tcctcgcgca cgactatctg      1020
     ggtgagatct tcggaactgc ctacgatctc agcacgattc tgatcctctg gtttgccggt      1080
     gcatcggcaa tggcagggtt gctcaatctt gttccgaggt atctcccccg ctacggcatg      1140
     gcgccgtcgt gggcccgcgc cgtgcgtccg ctggtcctcg tgttcagcgt catcgccatc      1200
     accgtcacga tctacttcga cgccggtgtc gacgctcaga gttccgcgta cgcaaccggt      1260
     gtcctcgtgc tcatctcgtc ggcgaccgtc gccgttgccc tgtccgcccg caagcacggt      1320
     cagcgaaaac tgttcgtggg gttcagtttt gtcgcagttt tgttcgtcta cacgacgatc      1380
     gcgaacatct tcgaacgccc ggacggtgtg aaagtcgcgt cgttcttcat cgccgcgatc      1440
     acggtggtgt ccttcctttc ccggatctcg cgagccttcg aactacgggc aacctctgtc      1500
     gaattcgacg agactgcact gcgattcatc gccgaggcag ccgagaaggg ttacctcgcg      1560
     atggtggcgc acgacgtcga tcgtctcgac gaggacgagt atcggaagaa ggaatcgcag      1620
     cagcgcgccg aaagcaacat cccggaggcg gagtcgatca tcttcatcga ggtcaacgtc      1680
     acggactcct ccgaattcag caccgacctc ctcgtccacg gccgacagcg cggtgagcac      1740
     cggatcctct gggtcgacag ccctgccgtc cccaacacca ttgcggcggt tctcctgcgg      1800
     acgagagaca tcaccggcgt gattcccgac gtctacttcg agtggaccga gggaaacccg      1860
     atcatgtacc tgctccgctt cctgttcatc ggtgagggcg aaaccgctcc cgtgacccgt      1920
     gaggttctcc gccgagccga acccgaccag tcccgacggc cacacgtcca cgtcggttga      1980
//

If you have problems or comments...

PBIL Back to PBIL home page