(data stored in ACNUC1104 zone)

EMBL: AP008957.PE614

AP008957.PE614       Location/Qualifiers
FT   CDS_pept        694118..695647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06140"
FT                   /product="putative LytR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31322"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNS0"
FT                   /protein_id="BAH31322.1"
FT                   /translation="MEPRPRHSATRHRRRRQPQRSTLSVGRKLAAASLSTTILVGVGIG
FT                   WYVQSDLTSGLYRSDALSALGEDAGSSLDGDTNILLIGLDSRKAMDGSDLPAEFVTDKL
FT                   HAGDSDVGGYNTNTLILLHVPGDGGKASAVAIPRDDYVSVPGYGMAKIKEAYGMAKADA
FT                   DAKLVADGVTDPAAREQQAREVGRRSTLTTVQNLLKVPIDHFAEVNLMGFYDVVSAIGP
FT                   VQVCLNNPVQDDFSGANFPAGVQTLDASQALSFVRQRHGLDNGDLDRTHRQQAFISAVI
FT                   ANLKGSGVIGNIPKMTALADVVKKDVVIDSAMDPVRFASQASALAGGNIDFYTLPIEGY
FT                   ETVDGQDVNMVDPARLRSEVSRIFAGGDSASAPAMDTAISTGNEVVDIRNGTATDGLGA
FT                   ALAAAMKASGVEVGEVSTAAATAKSVVSYGVGAKAVAEALAEQLGVAAVPNEQAAAESV
FT                   SVLIGEDNAQTVFSAAPAQSDSSVSAGTVPDTGAQGSPIRADANGGIPCVD"
     gtggaaccgc gacctcgaca ctcggcaacc aggcacaggc gtaggcgtca accgcagcgg        60
     tcgacgctct cggtagggcg caagctggcg gcggcgtccc tgtcgacgac gattctggtg       120
     ggcgtcggaa tcgggtggta cgtgcagtcg gatctgacgt cggggctgta ccggtcggat       180
     gcgctctccg ccctcggtga ggacgcggga agttctctcg acggggatac caacatcttg       240
     ttgatcgggc tcgacagtcg caaggcgatg gacggcagtg acctgccggc agagttcgtc       300
     accgacaagt tgcacgcagg ggatagcgat gtgggtgggt acaacacgaa cacgcttatc       360
     ctgctccatg ttccgggcga tggtggcaag gccagtgcag tggcgattcc acgcgacgat       420
     tacgtctctg tacccggcta tggaatggcc aagatcaagg aagcctacgg aatggcgaag       480
     gctgatgcgg acgccaaact cgtagcggac ggtgtgacgg atcctgctgc acgagaacag       540
     caagcgcgtg aagtcggtcg gcggtcgaca ctgaccaccg tgcagaatct gctcaaggtt       600
     ccgatcgatc actttgccga agtgaacctg atgggcttct atgacgtcgt ctcggctatc       660
     ggccctgttc aggtgtgcct caacaatccg gtgcaggatg acttctcggg cgccaacttc       720
     ccggcggggg ttcagactct cgatgcgtca caggcacttt cgtttgtccg tcaacgccac       780
     ggcctggaca acggggactt ggatcgcacc catcggcagc aggctttcat cagcgcggtg       840
     atcgccaact tgaagggctc cggcgtcatc ggaaacattc cgaagatgac ggcactggcc       900
     gacgtggtga agaaggacgt ggtgatcgat tccgccatgg atcccgtccg attcgcttct       960
     caggcaagcg ctctcgcggg tggaaacatc gacttctaca ccctgcccat cgagggatac      1020
     gagaccgtcg acggccagga cgtcaacatg gttgatccgg cgcgtctgcg tagcgaagtg      1080
     tcgcggatct tcgcgggagg tgactcggca tctgcacctg cgatggacac cgcgatctcg      1140
     accgggaacg aagttgtgga tatccgcaac ggaaccgcga cggacgggtt gggcgccgcg      1200
     ttggcagcgg cgatgaaagc gtcgggagtc gaagtcggag aggtgagcac cgcagctgcg      1260
     acggcaaagt cggtggtcag ctatggagtc ggcgccaaag ccgtcgcaga ggcgctggcc      1320
     gagcagttgg gcgtggccgc agtgccgaac gagcaggcag cggccgaatc agtgtctgta      1380
     ctgatcggtg aggacaatgc gcagaccgtg ttctcggccg ctccggcgca gtcggactcc      1440
     tcggtatccg ccggcacagt tcccgatacg ggagcgcagg gatcacctat ccgagcggac      1500
     gcgaatggcg gcattccctg tgtggactaa                                       1530
//

If you have problems or comments...

PBIL Back to PBIL home page