(data stored in ACNUC1104 zone)

EMBL: AP008957.PE619

AP008957.PE619       Location/Qualifiers
FT   CDS_pept        698956..700029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31327"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="InterPro:IPR022454"
FT                   /db_xref="InterPro:IPR042271"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNS5"
FT                   /protein_id="BAH31327.1"
FT                   /translation="MAEKTPQDDEASAPLGGAVDWSLAAKAGIKLARGGPAMSRYTAET
FT                   ATAELAEASKRAELPVREVTGLADGLPVPAADVLDRAGWITAASRSMAHLTGADPDGSG
FT                   NLIVGKPAGLQAGAMLAYLSSAILGQYDPFTGEHGTLLLVTPNIVSVERSLRLNPSDFR
FT                   LWVCLHEVTHRVQFSSSPWLAEYMKESVETLGATVDESMTDVVGRLAAELRSRKEPDSS
FT                   DGATAGGIIGLLRASQAEPQRDALDRMLVLGTLLEGHADHVMDAVGPAVVPSVATIRAA
FT                   FDKRRQRKSNPVQRIIKMLLGMDAKMAQYVRGKAFVDAVVLKVGMEQFNTIWTGPEALP
FT                   LLDEIDNPDAWVKRVLG"
     gtggccgaaa agactccaca agatgatgaa gcctcggctc cgctcggtgg tgccgtcgac        60
     tggagtcttg ccgccaaagc cgggataaaa ctggcgcgcg gcggccccgc gatgtctcgc       120
     tacacggccg agacggcaac cgcagaactc gccgaagcgt ccaagcgcgc agaactgccg       180
     gttcgtgaag tgaccgggct ggccgacggt ctaccggtcc cggccgctga cgtgcttgac       240
     cgggccgggt ggatcacggc agcctcgcgg tcgatggcgc atctcaccgg cgccgaccct       300
     gacggcagtg gcaatctcat cgtcggaaag ccggcgggct tgcaggccgg cgccatgctg       360
     gcgtacctgt cttcggcgat cctcgggcag tacgacccgt tcaccggcga gcacggcacc       420
     ctgcttctgg tcacaccgaa catcgtctcc gtcgaacggt cccttcggct gaatccgagt       480
     gacttccggt tgtgggtctg cctgcacgag gtcactcacc gggttcagtt ctcgtcctca       540
     ccgtggttag cggagtacat gaaggaatcc gtcgaaacgc ttggtgcgac ggtggacgag       600
     tcgatgaccg acgttgtcgg gcgccttgct gcagagctgc gctcgcggaa ggaacccgac       660
     tccagtgacg gtgcgacggc gggcgggatc atcggcctgc tgcgtgcttc gcaggcggaa       720
     ccccagcgtg acgcgctgga tcggatgctc gtactcggca ccctcctcga agggcatgca       780
     gaccacgtga tggacgccgt cggccccgcc gtggtgccgt cggtggcaac tatccgcgcg       840
     gccttcgaca agcgtcggca gcgcaagtcc aaccccgtgc agcggatcat caagatgctt       900
     ctcggcatgg acgccaagat ggcgcagtac gtacgcggca aggccttcgt cgacgcggta       960
     gttctcaagg tcggcatgga gcagttcaac accatctgga ccgggcccga ggccttgccg      1020
     ttgctcgacg agatcgacaa tcccgacgcg tgggtaaagc gcgttctcgg ctag            1074
//

If you have problems or comments...

PBIL Back to PBIL home page