(data stored in ACNUC1104 zone)

EMBL: AP008957.PE622

AP008957.PE622       Location/Qualifiers
FT   CDS_pept        702485..704131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31330"
FT                   /db_xref="GOA:C0ZNS8"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNS8"
FT                   /protein_id="BAH31330.1"
FT                   /translation="MLSELDPVETRQVRPSLPKKSSTSDLESILFVIVERGERTPREQH
FT                   YPYVTLERDPWDDYTFRTLFSLTIYLDRTSMVRIGDVKIMKLGQGGGPTSFVDRRFKGL
FT                   PVNYCSLGQSYTYYNLVKELPAKVADMLLRGINDVVYRPGIRDAFEDEEVFQLSLLRTG
FT                   SAMTAFRDAPNLFISGLVQVSEPTVILGFNTDVGGGTFPIRFIFNDSPNLPDRINAIIG
FT                   YNGSGKTQLMANLAMVATASIHRRNVDEYGVFEDAATIFSSVIAISYSAFDTFAMPDEI
FT                   WHTDRERSMVSARLRLGASTFGYTYCGLRRLVSVGSQENSPPVRPLKSIEDLTADFTIA
FT                   LDIAQGSDKGAVLTKALQSLGREPSFGRIGLDRFLAMESTNWHSQFEKLSTGHKIVLNI
FT                   IAHIVCYSEPKSLVLIDEPESHLHPSLLSAFMNSLSGILRDLDCFAVIATHSPVVIQEI
FT                   PRRYVRVLKRIGNSTRVEEVVQETFAENIGSLTSSVFDLDSTATDFHEVLRNLAENRSL
FT                   EEIDTIFGGEMSIQGRAYVRSIQRQLRDSNA"
     atgctaagtg aactcgatcc tgttgagacg cgtcaggttc gcccctcctt accgaaaaaa        60
     tcctcgactt cggaccttga atctattcta ttcgttatcg ttgaacgagg ggaacgtacg       120
     cctcgtgagc agcattatcc ctatgtgaca cttgagcgtg atccttggga tgactacacc       180
     tttcgaacac ttttctcttt aactatctat ttggaccgta catctatggt tcgaattgga       240
     gatgtgaaga ttatgaagct tggccaaggt ggcgggccaa catcattcgt cgatagaaga       300
     ttcaagggcc tccctgttaa ctattgctcg ctggggcaat cgtatactta ttataatctc       360
     gttaaggagc ttcccgcaaa agtggcggat atgctcctgc gcgggatcaa tgacgtggtt       420
     taccgtcccg gaatcaggga tgcatttgaa gacgaggagg tatttcaact atctctactg       480
     cggaccgggt cggcaatgac tgcgtttagg gacgcgccga acttgtttat ttcagggtta       540
     gtccaggttt ccgagccaac agtaattctg ggattcaaca ctgatgtggg aggagggact       600
     tttccaatca ggttcatatt caacgattcg ccgaatttgc ctgatcggat caatgcgata       660
     attgggtaca acggttcagg taagacacaa ttgatggcaa atttggccat ggttgcaacg       720
     gctagcatcc atcgaagaaa tgttgacgag tacggagtat tcgaagatgc tgcaaccata       780
     ttcagttcgg taatagcaat ttcctacagc gcttttgata cattcgcgat gcctgacgaa       840
     atatggcaca ccgatcgtga gagatctatg gtaagtgcac gtctccgttt gggtgcaagt       900
     actttcggat atacgtattg tggtctgcgt aggttagttt ctgtcggttc tcaagagaat       960
     tctccaccgg ttcggccgct gaaatccatt gaggacctaa ctgcggactt cacaatcgct      1020
     cttgacattg cgcaaggttc ggataagggt gcggttttga cgaaagcgtt gcaatcgctt      1080
     gggcgagaac cgtctttcgg tcggatcggg cttgatcgtt ttcttgctat ggaaagcaca      1140
     aattggcaca gtcagttcga gaaattaagt acaggtcata agattgtcct aaatattatt      1200
     gcgcatatcg tttgctatag cgagcccaaa agtcttgttt tgattgacga gccagagtcg      1260
     catttgcatc cctctctttt atctgcattt atgaattcac tcagtgggat acttcgagat      1320
     cttgattgct ttgcggttat tgcaacgcat tcaccagttg tgattcaaga gatccctaga      1380
     aggtacgtgc gcgttcttaa gagaattggc aattccacgc gagtggagga agtagttcag      1440
     gagaccttcg ctgagaacat tggatccctg acgagtagtg tctttgacct tgatagtacg      1500
     gctaccgact tccacgaggt gctgaggaat ctggcggaaa accgctcgtt agaggagatc      1560
     gacacgattt tcggcgggga gatgagcatc caaggccgtg cttatgtacg gtccatccag      1620
     cgacagctta gagatagcaa tgcttga                                          1647
//

If you have problems or comments...

PBIL Back to PBIL home page