(data stored in ACNUC1104 zone)

EMBL: AP008957.PE623

AP008957.PE623       Location/Qualifiers
FT   CDS_pept        704082..704954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31331"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNS9"
FT                   /protein_id="BAH31331.1"
FT                   /translation="MLMYGPSSDSLEIAMLERSPLLRDEIADFETVCASRKLNSVKIML
FT                   GSLRDTVVSLYSVYRSKSGSPLISPVCVFSPEVLAALESNYNLTYEGKSLGDLRVEILK
FT                   NSIGNFCSLCGARPFYGLDHYLPKVIYPEYSILSSNLVPCCSQCNTKKASIVGSANGRF
FT                   LHANFDSFASVESWLHCDVRSDAEFVDTVFSVSKRLPAAVQGDAEFHLLKLELDSAYSK
FT                   MAIGELISIKGLLEEAFLDGGEIAVIFELRRLQRSIVRGFGVHFWKNALYEGLCADRGF
FT                   VSGGFAKIC"
     gtgcttatgt acggtccatc cagcgacagc ttagagatag caatgcttga gagatctccg        60
     ctgcttcgag acgaaattgc ggatttcgaa acagtgtgcg caagccgtaa attgaactcg       120
     gtaaagatta tgctcggttc acttcgcgat acagtcgtat ccttgtattc agtctaccgt       180
     agcaaatcgg gttcaccgtt gatttcgcct gtgtgtgtct tctctccgga agttttggct       240
     gctctggaga gtaattataa tttgacatat gaaggtaaat ctcttggaga tcttcgggtt       300
     gagatcttaa agaattcaat tggaaatttt tgctcacttt gcggggcgcg acccttttat       360
     gggctggatc attaccttcc taaggtgata taccctgagt atagtattct ttcctccaat       420
     ctggttccgt gttgcagtca gtgcaatact aaaaaagcct cgattgtcgg ttcggcaaac       480
     ggacgattct tgcatgcaaa ttttgatagt tttgcttcgg ttgagagttg gctgcattgc       540
     gacgtgagat ctgatgcgga atttgttgat acagtattct cggtaagtaa gagacttccg       600
     gctgcagtgc aaggagacgc ggaatttcat ctcctaaagc tcgaactcga ttcggcatat       660
     tcgaaaatgg ctattggtga gctgatttcc attaagggat tactggaaga ggcctttttg       720
     gatggggggg aaattgctgt catattcgaa ttgcgacggt tgcaacgtag cattgtgcgg       780
     ggtttcgggg ttcatttctg gaagaatgcg ttatatgaag gattgtgtgc ggatcgcgga       840
     ttcgtctcag gagggtttgc gaaaatatgt tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page