(data stored in ACNUC1104 zone)

EMBL: AP008957.PE64

AP008957.PE64        Location/Qualifiers
FT   CDS_pept        81492..82448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00640"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30772"
FT                   /db_xref="GOA:C0ZL82"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZL82"
FT                   /protein_id="BAH30772.1"
FT                   /translation="MNIGAIGKKLGQLVIVILIVSFGTFVLASLIPGDPAVSVLGEGRT
FT                   PAEYEEVRQQLGLNDPLLVRYWDWLTSALQGDLGNSLVPPQQDVLTAIGSALPVSVQLA
FT                   VMGLVIALVVAVPLALWSAHHEGGVIDRVISAATFGVLSVPSFLAGLLLIMVTVNWLGW
FT                   FPRSQWVRIGDSLSGNLSHAILPAITISLLEMAMFTRVLRSDLVTTLREDYILASKAKG
FT                   MPTLRVLFSDALRPSSFSLITMMGLALGGMIGSTVIVETLFSLPGMGTLIVRAAQQGDS
FT                   PMLLGAVVVIAVIYVLVNSAIDVLYTYLDPRSRRVHV"
     atgaacatcg gcgcaatagg taagaaattg ggccagctcg tcattgtgat cctgatcgtc        60
     agcttcggaa ccttcgtgct ggcatcactg atccccggcg atcctgctgt ctccgttctc       120
     ggcgaaggcc gaacgcccgc cgagtacgag gaagttcggc agcagctcgg gctcaacgat       180
     ccactcctgg ttcgctattg ggactggttg accagcgctc tccagggcga cctcggtaat       240
     tcgcttgttc ccccgcagca ggacgttctg actgcgatcg gctcggcgct gcccgtcagc       300
     gttcagttgg ccgtgatggg tctggtcatc gcactcgtcg tcgccgtgcc gctcgcactc       360
     tggtcggcgc accacgaagg cggcgtcatc gaccgcgtaa tcagcgccgc gacgttcggt       420
     gttctttccg tcccgagctt cctcgccggt ctgttgctga tcatggtcac cgtcaactgg       480
     ctcggctggt tcccgcgatc acagtgggtg cgcatcgggg acagcctctc cggaaacctc       540
     tcacacgcaa tacttcccgc gatcaccatc agtctcctcg agatggcgat gttcactcgc       600
     gttcttcgat ccgatctggt gacgacgctc cgtgaggatt acatcctcgc gtcgaaggcc       660
     aagggaatgc ccacgctgcg agtgcttttc agtgacgcgc ttcgcccgtc gtcgttctcg       720
     ctcatcacga tgatgggtct ggctctcggc ggcatgatcg gcagcaccgt gatcgtcgag       780
     acgctcttct cgttgcccgg aatgggcacg ctcatcgtcc gcgcagcgca gcaaggtgat       840
     tcgccgatgc tgcttggcgc ggtggtcgtg atcgcggtca tctacgtcct cgtcaacagt       900
     gcgatcgatg ttctgtacac ctatcttgac ccgaggagtc gtcgtgtcca tgtctga          957
//

If you have problems or comments...

PBIL Back to PBIL home page