(data stored in ACNUC1104 zone)

EMBL: AP008957.PE648

AP008957.PE648       Location/Qualifiers
FT   CDS_pept        complement(727080..728669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06480"
FT                   /product="putative fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.-"
FT                   /note="protein synonym:acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31356"
FT                   /db_xref="GOA:C0ZPM8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPM8"
FT                   /protein_id="BAH31356.1"
FT                   /translation="MASTDAVSEAQRSRRTNWNNQIARHAQMIPDRTALRFLGDSITWS
FT                   TLDARVEKLADALARRGVSFGDRVLILMLNRPEYLEIVLATNALGAIAVPVNFRLTPPE
FT                   VAYLVNDSGSKVIVAEGPLAPLAGAARAVSEGIDISITVGAPAEGDSLNYEDLISEAGE
FT                   PHAFVDIPDDTPALIMYTSGTTGRPKGSVLSHSNLSSQALTCIRAFHLFNADSIGFCAS
FT                   PMFHIAALGSIAPSLQLGTTTVIHPVGAFDPGQLLDILEAEKVTSLFLVPVQWQAVCAV
FT                   QKAQPRALSLKNISWGAAPSSDTILRAMAETFPDAFNVAVFGQTEMSPITCVLDGEDAI
FT                   RKLGSVGRVIPTISARVVDENMDDVAPGEIGEIVYRGPTMMSEYWNNPTATADAFHGGW
FT                   FHSGDLVRVDDEGFVYVVDRKKDMIISGGENIYCAEVENVLYEHELIVEAAVVGRPDAK
FT                   WGEVPVAIVAMAPGSAVDLTIEELSSFLNDRLARYKHPKDIVVVEALPRNASGKVVKGE
FT                   LREKVRAVDAVS"
     atggcctcca ccgatgcagt ctccgaggcg cagcgttcac gccgcaccaa ctggaacaat        60
     cagatcgcca ggcatgcgca gatgattccc gatcgcaccg cgctgcgatt cttgggcgat       120
     tccatcacct ggagcaccct cgacgcacgc gtcgagaagc tggcagacgc tctagcccga       180
     cgcggcgtca gcttcggcga ccgcgtgctc atcctgatgc tcaatcgccc cgaatacctc       240
     gagatcgtgc tcgcgaccaa cgcactgggc gcgatagctg ttccggtgaa cttccgtctc       300
     acgccacccg aggtcgctta cctggtcaac gactccggct ccaaagtcat tgtcgccgaa       360
     ggaccactgg ctccactggc cggagcggcg cgtgccgtgt cagagggtat cgacatctcc       420
     atcaccgtgg gcgcccccgc cgagggtgac agcctgaact acgaggacct gatcagcgag       480
     gcgggcgagc cgcacgcgtt cgtcgacatc ccggacgaca ctcctgcact catcatgtac       540
     acctcgggaa ccaccggtcg ccccaagggt tcggtgctct cccactccaa cctgtcttcg       600
     caagcattga cctgtatcag ggccttccac ctgttcaatg ccgattccat cggcttctgc       660
     gcgtcgccca tgttccacat cgcggccctc ggttccatcg cgccgagcct gcaactcggc       720
     acgaccacgg tgatccatcc ggtcggcgca ttcgaccctg gtcaactact cgacattctc       780
     gaagccgaga aggtcaccag cttgttcctc gtgcccgtgc aatggcaggc cgtgtgcgca       840
     gtgcagaagg cgcaacctcg agcactgtcg ctgaagaaca tctcgtgggg cgccgcacca       900
     tcgtccgata ccatcctgcg ggcaatggcc gaaaccttcc cggacgcgtt caatgtcgca       960
     gtcttcggtc agaccgagat gtcgcccatc acttgcgttc tcgacggtga ggatgcgatt      1020
     cgcaagctcg gatccgtcgg tcgggtcatc ccgaccattt cggccagggt cgtcgacgag      1080
     aacatggacg acgtggcgcc cggtgaaatc ggtgaaatcg tctaccgcgg gcccacgatg      1140
     atgagcgagt actggaacaa ccccaccgcc accgctgacg ccttccacgg tggatggttc      1200
     cactccggcg atctcgttcg agtcgacgac gaaggctttg tctacgtcgt cgatcgcaag      1260
     aaggacatga tcatctccgg cggagagaac atctactgcg ccgaggtgga aaacgttctc      1320
     tacgaacacg aattgatcgt cgaagcggcc gtcgtcggtc gccccgatgc caagtggggt      1380
     gaggtgccgg tagcgatcgt cgcgatggcg ccaggttcag ccgtggacct gaccatcgag      1440
     gaactgagca gcttcctcaa tgatcgtctc gcgcgctaca agcacccgaa ggacatcgtc      1500
     gtcgtggaag cgctgccgcg caatgcaagc ggcaaggtcg tcaagggcga actgcgagag      1560
     aaggttcgag cggtcgacgc agtttcctga                                       1590
//

If you have problems or comments...

PBIL Back to PBIL home page