(data stored in ACNUC1104 zone)

EMBL: AP008957.PE65

AP008957.PE65        Location/Qualifiers
FT   CDS_pept        82450..83535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00650"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30773"
FT                   /db_xref="GOA:C0ZL83"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZL83"
FT                   /protein_id="BAH30773.1"
FT                   /translation="MTPDGAAPSPAPSEVMTYRQQTVLLAPGPVETLEQPKNLVLIGSI
FT                   LTVIGVALLGTALFGSAIMMTVRIVLALVALVFLFKGLGKLGTSKWGSQFDLSYWLACI
FT                   WLAALILAAIFAPLLPLGEYKDTVKTLAEPGFASPSLLSDHPLGTNNFGLDLLARALFG
FT                   ARASLTVAICAVLIGMIIGGTIGVMAGYFRGKVDAVVGILTNSLLAIPSLVLLIALAAV
FT                   LTSNLRNITLALSILCIPSMVRIARANTIVVAQREFVLAARAMGATKWRVIWRELVPNV
FT                   LVPVAALGLVAVSGLIVAEASLSFLGLGIAQPDPTWGNMIAEGQGGIVEKHPFIVLVPG
FT                   VFLFLTVFSFNLIGEKYRSKL"
     gtgacgccag acggagcggc cccgtcgccg gccccgtccg aggtgatgac ataccggcag        60
     cagacagtcc tgctggctcc cggccccgtc gagacgttgg aacagcccaa gaatctggtc       120
     ctgatcggat cgattctcac ggtgatcggc gttgcgctgc tcggcaccgc actcttcggt       180
     tcggccatca tgatgaccgt ccgcatcgtg ctcgcgctcg ttgccctggt tttcctcttc       240
     aagggtctcg gcaaactcgg tacgtccaag tggggcagtc agttcgatct ctcgtactgg       300
     ttggcgtgca tctggctggc cgcgctgatc ctggccgcga tcttcgcacc gctgctgccg       360
     ctcggtgagt acaaggacac ggtcaagacc ttggccgagc cgggcttcgc ctcgccgagc       420
     ctgctctccg atcacccgtt gggtaccaac aacttcggtc tcgacctgct tgcccgcgct       480
     ttgttcggtg ctcgcgcatc cttgaccgtg gccatctgcg ccgtactgat cggcatgatc       540
     atcggcggca ccatcggcgt catggccggt tacttccgcg gcaaggtcga cgcagtcgtc       600
     ggaatcctga ccaactcgct gctggccatt ccttctctgg tgctgttgat cgcactggcc       660
     gcggtgctca cgtcgaacct gcgcaacatc accctcgcac tctcgattct ctgcattccc       720
     agcatggttc gaatcgccag ggccaacacc atcgtcgtcg cccaacggga gttcgtgctt       780
     gccgcgcggg ccatgggcgc caccaaatgg cgcgtcatct ggcgcgagtt ggttcccaac       840
     gtcctcgttc cggtcgccgc gctcggcctg gtggccgtct ccggcctgat cgtcgcggaa       900
     gcatcactca gcttcctcgg actcggtatc gcacaacctg atccgacctg gggcaacatg       960
     attgcggaag gccagggcgg gatcgtggag aagcatccgt tcatcgttct ggttcccggc      1020
     gtcttcctct tcctgacggt gttctccttc aacctcatcg gcgagaagta tcggagtaag      1080
     ctgtga                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page